DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and Ccne2

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001032211.1 Gene:Ccne2 / 12448 MGIID:1329034 Length:404 Species:Mus musculus


Alignment Length:291 Identity:64/291 - (21%)
Similarity:117/291 - (40%) Gaps:63/291 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LSPQLNERRRMLQLLKLATSAHKLSRCALHLAVYYMDRFVDYYK-IRPDKLLLVAITCLHIAAQI 123
            |.||:  |..:|..|......:.|.|...:||..:.|||:...| :..:.|.|:.||.|.||:::
Mouse   137 LEPQM--RSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDVNKNMLQLIGITSLFIASKL 199

  Fly   124 ENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFLNFELIRPTTASFVELFACSFLTRSDFKN 188
            |  :.:.|:..|...:...|.:..:...:|..||..|.:||...|..|::.|    ||.....|:
Mouse   200 E--EIYAPKLQEFAYVTDGACSEVDILKMELNILKALKWELCPVTVISWLNL----FLQVDAVKD 258

  Fly   189 YIE-MLDEYERNHHTQPYQRYISFEEMLSILAQLLLRMADYTLYISRFANDLPSLLAAAC----- 247
            ..: :|.:|.:       :.:|...::|. |..|.:...::...|          ||||.     
Mouse   259 VPKVLLPQYSQ-------ETFIQIAQLLD-LCILAIDSLEFQYRI----------LAAAALCHFT 305

  Fly   248 -IAAVRQVSGVRRWS------EYLVGLTSYTEA------------------NVEP---YMNVLTD 284
             |..|::.||: .|.      :::|...|..::                  |::.   |:.:|.:
Mouse   306 SIEVVKKASGL-EWDDISECVDWMVPFVSVVKSVSPVKLKTFKKIPMEDRHNIQTHTNYLALLNE 369

  Fly   285 YYYYHVIQTDYGSPSVQTNQSLASPDSGFEE 315
            ..|.::.:.. |..|...|..:.:|....|:
Mouse   370 VNYVNIYRKG-GQLSPVCNGGIMTPPKSTEK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 29/104 (28%)
Cyclin_C <225..>286 CDD:281044 15/93 (16%)
Ccne2NP_001032211.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41
Cyclin_N 112..239 CDD:365896 30/105 (29%)
Cyclin_C 241..361 CDD:367282 25/142 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.