DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and Ccna2

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_033958.2 Gene:Ccna2 / 12428 MGIID:108069 Length:422 Species:Mus musculus


Alignment Length:302 Identity:78/302 - (25%)
Similarity:126/302 - (41%) Gaps:53/302 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DYARDIFLTMREQELSRRP-LFYLSPQ---LNERRRML-QLLKLATSAHKLSRCALHLAVYYMDR 97
            ||..||...:||.|:..:| :.|:..|   .|..|.:| ..|......:||....|||||.|:||
Mouse   167 DYQEDIHTYLREMEVKCKPKVGYMKRQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDR 231

  Fly    98 FVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFLNF 162
            |:....:...||.||....:.:|::.|  :.:.|..:|...:..:.|:..:...:|..:|..|.|
Mouse   232 FLSSMSVLRGKLQLVGTAAMLLASKFE--EIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAF 294

  Fly   163 ELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSILAQLLLRMAD 227
            :|..||...|:..:   ||                   |.||..  ...|.:...|.:|.|..||
Mouse   295 DLAAPTVNQFLTQY---FL-------------------HLQPAN--CKVESLAMFLGELSLIDAD 335

  Fly   228 -YTLYISRFANDLPSLLAAACI-AAVRQVSGVRRWSEYLVGLTSYTEANVEPYMNVLTDYYYYHV 290
             |..|       ||||:|.|.. .|:..|:| :.|.|.|...|.||..:::|   .|.|.:..::
Mouse   336 PYLKY-------LPSLIAGAAFHLALYTVTG-QSWPESLAQQTGYTLESLKP---CLVDLHQTYL 389

  Fly   291 IQTDYGSPSVQTNQSLASPDSGFEESFTENTNLVVSDEVVTV 332
            ....:...|::..         ::.|...:.:|:...|.::|
Mouse   390 KAPQHAQQSIREK---------YKHSKYHSVSLLNPPETLSV 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 36/126 (29%)
Cyclin_C <225..>286 CDD:281044 22/62 (35%)
Ccna2NP_033958.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62
Cyclin_N2 22..152 CDD:293109
Cyclin_N 171..297 CDD:278560 36/127 (28%)
Cyclin_C 299..417 CDD:281044 37/161 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.