DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and Ccna1

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001292150.1 Gene:Ccna1 / 12427 MGIID:108042 Length:421 Species:Mus musculus


Alignment Length:252 Identity:67/252 - (26%)
Similarity:104/252 - (41%) Gaps:38/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LTDYARDIFLTMREQELSRRP-LFYL--SPQLNERRR--MLQLLKLATSAHKLSRCALHLAVYYM 95
            :|:||.:|...:||.|:..|| ..|:  .|.:.|..|  ::..|......:||....|:|||.::
Mouse   164 VTEYAEEIHRYLREAEVRHRPKAHYMRKQPDITEGMRAILVDWLVEVGEEYKLRTETLYLAVNFL 228

  Fly    96 DRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFL 160
            |||:....:...||.||....:.:|::.|  :.:.|...|...:..:.||..:...:|..:|..|
Mouse   229 DRFLSCMSVLRGKLQLVGTAAILLASKYE--EIYPPDVDEFVYITDDTYTKRQLLRMEHLLLKVL 291

  Fly   161 NFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSILAQLLLRM 225
            .|:|..|||..|                    |.:|.|....     .|..|.:...:|:|.|..
Mouse   292 AFDLTVPTTNQF--------------------LLQYLRRQGV-----CIRTENLAKYVAELSLLE 331

  Fly   226 ADYTLYISRFANDLPSLLAAACIAAVRQVSGVRRWSEYLVGLTSYTEANVEPYMNVL 282
            ||      .|...||||:|||.......:.....|.|.|...|.|:...:.|.::.|
Mouse   332 AD------PFLKYLPSLVAAAAYCLANYIVNRHFWPETLAAFTGYSLNEIVPCLSEL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 34/126 (27%)
Cyclin_C <225..>286 CDD:281044 17/58 (29%)
Ccna1NP_001292150.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Cyclin_N2 27..>101 CDD:406812
CYCLIN_CCNA1_rpt1 132..294 CDD:410263 36/131 (27%)
CYCLIN_CCNA1_rpt2 298..420 CDD:410266 29/116 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.