DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and Ccnf

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:XP_038941012.1 Gene:Ccnf / 117524 RGDID:67401 Length:818 Species:Rattus norvegicus


Alignment Length:341 Identity:72/341 - (21%)
Similarity:134/341 - (39%) Gaps:65/341 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LTMREQELSRRPLFYLSPQLNERRRML---QLLKLATSAHKLSRCALHLAVYYMDRFVDYYKIRP 106
            |....|.::::.:|.:...|::..|.:   .|:::||.....|.| |||.|..:||::....:..
  Rat   324 LFQASQAVNKQQIFSVQKGLSDTMRYILIDWLVEVATMKDFTSLC-LHLTVECVDRYLRRRLVPR 387

  Fly   107 DKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFLNFELIRPTTAS 171
            .||.|:.|.|:.|..:..:.:....|  |...|..|.|...:...|..:|:..|..::..||...
  Rat   388 YKLQLLGIACMVICTRFISKEILTIR--EAVWLTDNTYKYEDLVRVMGEIISALEGKIRIPTVVD 450

  Fly   172 FVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSILAQLLLRMADYTLYISRFA 236
            :.|:.             :.::....|..|            :.|.|.:|.|.....::|     
  Rat   451 YKEVL-------------LTLVPVAPRTQH------------LCSFLCELTLLHTSLSVY----- 485

  Fly   237 NDLPSLLAAACIAAVRQVSG-VRRWSEYLVGLTSYTEANVEPYMNVLTDYYYYHVIQTDYGSPSV 300
              .|:.||:|.:...|.:.| .:.|:..|..||.::.:::.|.:..|....::.....||     
  Rat   486 --APARLASAALLLARLMHGHTQPWTTQLWDLTGFSYSDLTPCVLSLHKKCFHDDAPKDY----- 543

  Fly   301 QTNQSLASPDSGFEESFTENTNLVVSDEVVT-VETYNIITVQLQDPSPHS-------STFLP--- 354
             ...||.:....||:...|.   :..:||:: .|..:.:.|:.:.|.|.|       .|||.   
  Rat   544 -RQVSLTAVKQRFEDKCYEE---ISQEEVLSYAELCSALGVKQESPEPPSFPSSGEIHTFLSSPS 604

  Fly   355 ------KEQTNLKRSR 364
                  |.:.:|:..|
  Rat   605 GRRSKRKRENSLQEDR 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 30/121 (25%)
Cyclin_C <225..>286 CDD:281044 13/61 (21%)
CcnfXP_038941012.1 FBOX 73..111 CDD:197608
CYCLIN_CCNF_rpt1 345..439 CDD:410225 25/96 (26%)
CYCLIN_CCNF_rpt2 467..578 CDD:410226 28/138 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.