DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and Ccna2

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:XP_008759125.1 Gene:Ccna2 / 114494 RGDID:621059 Length:445 Species:Rattus norvegicus


Alignment Length:266 Identity:75/266 - (28%)
Similarity:114/266 - (42%) Gaps:41/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ERLAKTHWLTDYARDIFLTMREQELSRRP-LFYLSPQ---LNERRRML-QLLKLATSAHKLSRCA 87
            |:....:.:.||..||...:||.|:..:| :.|:..|   .|..|.:| ..|......:||....
  Rat   180 EKPVNVNEVPDYHEDIHTYLREMEVKCKPKVSYMKRQPDITNSMRAILVDWLVEVGEEYKLQNET 244

  Fly    88 LHLAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAV 152
            |||||.|:|||:....:...||.||....:.:|::.|  :.:.|..:|...:..:.|:..:...:
  Rat   245 LHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFE--EIYPPEVAEFVYITDDTYSKKQVLRM 307

  Fly   153 ERKILCFLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSI 217
            |..:|..|.|:|..||...|:..:   ||                   |.||..  ...|.:...
  Rat   308 EHLVLKVLAFDLAAPTVNQFLTQY---FL-------------------HLQPAN--CKVESLAMF 348

  Fly   218 LAQLLLRMAD-YTLYISRFANDLPSLLAAACI-AAVRQVSGVRRWSEYLVGLTSYTEANVEPYMN 280
            |.:|.|..|| |..|       ||||:|.|.. .|:..|:| :.|.|.||..|.||..:::|.:.
  Rat   349 LGELSLIDADPYLKY-------LPSLIAGAAFHLALYTVTG-QSWPESLVQKTGYTLESLKPCLM 405

  Fly   281 VLTDYY 286
            .|...|
  Rat   406 DLHQTY 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 36/126 (29%)
Cyclin_C <225..>286 CDD:281044 22/62 (35%)
Ccna2XP_008759125.1 Cyclin_N2 17..174 CDD:293109
Cyclin_N 194..320 CDD:278560 36/127 (28%)
Cyclin_C 322..440 CDD:281044 35/122 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.