DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CCNI

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001335061.1 Gene:CCNI / 10983 HGNCID:1595 Length:377 Species:Homo sapiens


Alignment Length:347 Identity:67/347 - (19%)
Similarity:126/347 - (36%) Gaps:56/347 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LSPQLNERRRMLQLLKLATSAHKLSRCALHLAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIE 124
            :||  ::|..::|.|........|......||...:|||:...|..|..|..:||:|..:||:..
Human    40 VSP--SQRDEVIQWLAKLKYQFNLYPETFALASSLLDRFLATVKAHPKYLSCIAISCFFLAAKTV 102

  Fly   125 NTDAFIPRYSEMNRLVKNAY---TAFEYKAVERKILCFLNFELIRPTTASFVELF-ACSFLTRSD 185
            ..|..||   .:..|.::::   ::.|...:||.||..||::|...|...|:.:| |.:..||..
Human   103 EEDERIP---VLKVLARDSFCGCSSSEILRMERIILDKLNWDLHTATPLDFLHIFHAIAVSTRPQ 164

  Fly   186 FKNYIEMLDEYERNH---------HTQPYQRYISFEEMLSILAQLLLRM-------ADYTL---- 230
            ....:..|...:  |         |.....:.:.|...:..||.:.|.|       ...|:    
Human   165 LLFSLPKLSPSQ--HLAVLTKQLLHCMACNQLLQFRGSMLALAMVSLEMEKLIPDWLSLTIELLQ 227

  Fly   231 --------------YISRFANDLPSLLAAACIAAVRQV--------SGVRRWSEYLVGLTSYTEA 273
                          .::...:.|.|.|....:...|.:        .||.|.....|....:::.
Human   228 KAQMDSSQLIHCRELVAHHLSTLQSSLPLNSVYVYRPLKHTLVTCDKGVFRLHPSSVPGPDFSKD 292

  Fly   274 NVEPYMNVLTDYYYYHVIQTDYGSPSVQTNQSLASPDSGFEESFTENTNLVVSDEVVTVETYNII 338
            |.:|.:.|.....:||.:....|.....|.:.:...:   .:.|.:....:.:::.|:....::.
Human   293 NSKPEVPVRGTAAFYHHLPAASGCKQTSTKRKVEEME---VDDFYDGIKRLYNEDNVSENVGSVC 354

  Fly   339 TVQLQDPSPHSSTFLPKEQTNL 360
            ...|.....|:|...|.:..::
Human   355 GTDLSRQEGHASPCPPLQPVSV 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 30/106 (28%)
Cyclin_C <225..>286 CDD:281044 13/93 (14%)
CCNINP_001335061.1 Cyclin_N 34..142 CDD:365896 30/106 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 357..377 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.