DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and LOC105948063

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:XP_012824177.1 Gene:LOC105948063 / 105948063 -ID:- Length:301 Species:Xenopus tropicalis


Alignment Length:220 Identity:47/220 - (21%)
Similarity:87/220 - (39%) Gaps:52/220 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 REQELSRRPLFYLSPQLNERRRMLQLLKLATSAHKLSRCALH-----------LAVYYMDRFVDY 101
            :.:|.|..|:.:|..|.|       :.:.:.||.......:|           |::..:.||:|.
 Frog    75 KSKEESFTPVNFLDKQPN-------ISETSWSAVTTQMINVHRKYGFDFETLCLSINMLQRFLDC 132

  Fly   102 YKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYT------AFEYKAVERKILCFL 160
            ..|....|..|..|||::|.::      :.::....:...||:|      ...| .:|:.||..|
 Frog   133 TPIEIANLKAVGATCLYVACKV------VEKHQPEKQNFLNAFTNTGLTPTLLY-GLEKLILQQL 190

  Fly   161 NFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSILAQLLLRM 225
            .:.|..||..||:|.::...::|:             :|.|....:   ..:.:|:..|...|.|
 Frog   191 QYRL
WAPTINSFLEYYSLQRMSRN-------------KNSHAHLTR---EVKTLLAAKAVAALSM 239

  Fly   226 ADYTLYISRFANDLPSLLAAACIAA 250
            ..|.....:     ||::|.:|:.|
 Frog   240 TSYKAQAHK-----PSVMAQSCLKA 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 28/132 (21%)
Cyclin_C <225..>286 CDD:281044 7/26 (27%)
LOC105948063XP_012824177.1 Cyclin_N 71..194 CDD:365896 28/132 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D359408at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.