DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and LOC105948062

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:XP_012824176.1 Gene:LOC105948062 / 105948062 -ID:- Length:301 Species:Xenopus tropicalis


Alignment Length:293 Identity:55/293 - (18%)
Similarity:106/293 - (36%) Gaps:86/293 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QNIFVVDRKLKKT----------CPQADVERLAKTH------------W------------LTDY 39
            :.|....|||::|          ..:|..::|...|            |            .:::
 Frog     2 ETIIFKKRKLEETSKGGEGRSTDSSEASNKKLKYDHQVPRGPVYLKDPWNSFGKIGEALKMFSEF 66

  Fly    40 ARDIFLTMREQELSRRPLFYLSPQLNERRRMLQLLKLATSAHKLSRCALH-----------LAVY 93
            ..:.:...:.:|.|..|:.:|..|.|       :.:.:.||.......:|           |::.
 Frog    67 GENGYQFNKSKEESFTPVNFLDKQPN-------ISETSWSAVTTQMINVHRKYGFDFETLCLSIN 124

  Fly    94 YMDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYT------AFEYKAV 152
            .:.|::|...|....|..|..|||::|.::      :.::....|....|:|      ...| .:
 Frog   125 MLQRYLDCTPIEIAILKAVGATCLYVACKV------VEKHHPKKRKFLKAFTNTGLTPTLLY-GL 182

  Fly   153 ERKILCFLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSI 217
            |:.||..|:..|..||..||:|.::...::|:             :|.|....:   ..:.:|:.
 Frog   183 EKLILKKLHCRLWAPTINSFLEYYSLQRMSRN-------------KNSHAHLTR---EVKTLLAA 231

  Fly   218 LAQLLLRMADYTLYISRFANDLPSLLAAACIAA 250
            .|...|.|..|.....:     ||::|.:|:.|
 Frog   232 KAVAALSMTSYKAQAHK-----PSIMAQSCLKA 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 27/138 (20%)
Cyclin_C <225..>286 CDD:281044 7/26 (27%)
LOC105948062XP_012824176.1 CYCLIN_SF 105..190 CDD:424085 18/91 (20%)
CYCLIN_SF 197..>266 CDD:424085 18/84 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D359408at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.