DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and ccno

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001373739.1 Gene:ccno / 101883490 -ID:- Length:300 Species:Danio rerio


Alignment Length:234 Identity:59/234 - (25%)
Similarity:96/234 - (41%) Gaps:23/234 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RLAKTHWLTDY--ARDIFLTMREQELSRRPLFYLS--PQLNERRRMLQLLKLATSAHKLS----R 85
            |.|....:.||  :...|:..|..:.....|..||  ||:....|...:..|.....:||    .
Zfish    25 RCASDSQVCDYEDSETCFIIQRLNQQQFLALNCLSRQPQITAEARSKLVSWLIAVRRQLSLSFES 89

  Fly    86 CALHLAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYK 150
            |.  |||..||||:....:..|...|:.:|.|.||.  :..:.:.||.:::..|..|:::..:..
Zfish    90 CC--LAVNIMDRFLITTSVAADCFQLLGVTSLLIAT--KQVEVYSPRITQLLSLCCNSFSREQLC 150

  Fly   151 AVERKILCFLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEML 215
            .:|..||..|||.|..||.|.|::.|...|......    |.:.....:.|.:|......:..:.
Zfish   151 NLECLILLRLNFRLAAPTLAFFLDYFTSRFTGHQTG----EFISAQNAHLHKEPSSAENKWRWLA 211

  Fly   216 SILAQLLLRMADYTLYISRFANDLPSLLAAACIAAVRQV 254
            ..:.:|.|  ||||     |...:||::|...:...:.:
Zfish   212 CKVCELSL--ADYT-----FNKYMPSVIAQCALKLAKDL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 35/127 (28%)
Cyclin_C <225..>286 CDD:281044 8/30 (27%)
ccnoNP_001373739.1 CYCLIN_SF 68..160 CDD:424085 25/95 (26%)
CYCLIN_SF 167..291 CDD:424085 19/88 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.