DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and XB997834

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:XP_017951851.1 Gene:XB997834 / 100487861 XenbaseID:XB-GENE-997835 Length:327 Species:Xenopus tropicalis


Alignment Length:249 Identity:55/249 - (22%)
Similarity:97/249 - (38%) Gaps:68/249 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DYARDIFLTMREQELSRRPLFYLSPQ--LNER--RRMLQLLKLATSAHKLSRCALHLAVYYMDRF 98
            ||....::..:..|....|..:|:.|  :|.:  :.::..:.:|..|.||....|.|||.|::||
 Frog    60 DYGETCYMFKKSLEEDFIPHNFLANQSDINAKCWKDVVITMIIAHRAFKLDFETLCLAVNYLERF 124

  Fly    99 VDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRL-VKNAYTAFEYKAVERKILCFLNF 162
            :....::...|.::..|||::|.::  .:..:|:.::...| .::.:||.....:||.:|..|.|
 Frog   125 LACTPLKAANLKVMGGTCLYLACKV--MEKSLPKINQFLALFCEDGFTAPLMSYLERLVLRRLCF 187

  Fly   163 ELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSILAQLLLRMAD 227
            .|..||...|:|.|:.                            |.:|.:|..:           
 Frog   188 RLGAPTIEYFLEHFSL----------------------------RRVSNKECPA----------- 213

  Fly   228 YTLYISRFANDL--------------------PSLLAAACIAAVRQVSGVRRWS 261
              ..|:|.||.|                    |||||..|:.|..|:.....|:
 Frog   214 --AKINRAANALTAARGIAALSMTKYGFPAYPPSLLAQCCLTAADQIFQYDPWN 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 30/126 (24%)
Cyclin_C <225..>286 CDD:281044 14/57 (25%)
XB997834XP_017951851.1 Cyclin_N 66..190 CDD:365896 30/125 (24%)
Cyclin_C 192..>268 CDD:367282 22/115 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.