DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and ccnj

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001128285.1 Gene:ccnj / 100038087 XenbaseID:XB-GENE-485597 Length:385 Species:Xenopus tropicalis


Alignment Length:330 Identity:84/330 - (25%)
Similarity:133/330 - (40%) Gaps:76/330 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 WLTDYARDIFLTMREQELSRRPLFYLSPQLNERRRMLQLLKLATSAHKLSRCALHLAVYYMDRFV 99
            |....|.||..|:|.:||........|||||.||....|:.:.::..||...|.|||||.:|.|:
 Frog     8 WKGQLAADIHQTLRYKELKLPSYKGQSPQLNLRRYFADLIAIVSNRFKLCPTARHLAVYLLDLFM 72

  Fly   100 DYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRL-----VKNAYTAFEYKAVERKILCF 159
            |.|.|...:|.:||::||.:|::.|:.:..:|:..::|.|     :....|......:|..:|..
 Frog    73 DRYDISIQQLHIVALSCLLLASKFEDKEDRVPKLDQLNSLGCMTNMNLVLTKQNLLHMELLLLET 137

  Fly   160 LNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSILAQLLLR 224
            ..:.|..||.|.|:|.:....:..:|.             |...|   .|..|:....:|    :
 Frog   138 FEWNLCLPTPAHFIEYYLSIAVHDTDL-------------HDGWP---MICLEKTKIYMA----K 182

  Fly   225 MADYTLYIS----RFANDLPSLLAAACIAAVRQVSGVR-RWSEYLVGLTSYT------------- 271
            .|||.|.:|    .|.|.:|||:||||:||.|.:..:. .|...|..||.|.             
 Frog   183 YADYFLEVSLQDHMFLNYVPSLVAAACVAASRIILRLSPSWPTRLHRLTVYAWDILVPCIERLLI 247

  Fly   272 ---------------------------------EANVEPYMNVLTDYYYYHVIQTDYGSPSVQTN 303
                                             :|:|:.:|.......:.|.:|..:.:|..|:.
 Frog   248 AHDNDVKEANKHKNQLSHTAAQCLFPPASPAPPQAHVQQHMPQYLQTQHPHQLQFHHSAPQSQSC 312

  Fly   304 QSLAS 308
            |.:.:
 Frog   313 QQIVT 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 40/126 (32%)
Cyclin_C <225..>286 CDD:281044 25/111 (23%)
ccnjNP_001128285.1 Cyclin_N 15..>109 CDD:365896 35/93 (38%)
Cyclin_C 145..>251 CDD:367282 33/125 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9861
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I4977
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D359408at33208
OrthoFinder 1 1.000 - - FOG0004344
OrthoInspector 1 1.000 - - oto105213
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.