DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment armi and LOC100360296

DIOPT Version :9

Sequence 1:NP_001014556.1 Gene:armi / 38427 FlyBaseID:FBgn0041164 Length:1188 Species:Drosophila melanogaster
Sequence 2:XP_008771545.2 Gene:LOC100360296 / 100360296 RGDID:2322455 Length:239 Species:Rattus norvegicus


Alignment Length:265 Identity:57/265 - (21%)
Similarity:104/265 - (39%) Gaps:53/265 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 IAELTHG------LSEMDVSKESSCTARKGVITSLDGDRGVIDKDVLFETKVAEDII---LDLHV 113
            |:...||      :||......:...:.:||:|||....|.|:..:||..:|..|.:   :..:|
  Rat     8 ISTFFHGSNTSEEISEEQPQDNTRLKSIQGVVTSLCNYYGWINDSILFNVEVISDNVPLKIGTNV 72

  Fly   114 GCVVEYLTFTTGEAMRVVKVKSILEHSWEDTSQKEIEKAVDNLKNEKPTFFNTETRSVLG-LISQ 177
            ..:||....|  ..::.:|||.:                .|..:..:|        |.|| .:..
  Rat    73 LALVEQDEVT--HTLKTIKVKVM----------------TDLPEGSEP--------SKLGKRLCI 111

  Fly   178 RLASSIDVETEY--GQLTVELDNIEMNFIPTNGDRVRLECNIQLDDGFVDKQG----EILEVTKL 236
            |..:|:..|..|  ..::..|......|.|..||.|.:|.::......::...    ...::.::
  Rat   112 RCVTSVTEEDVYISEDVSFPLYLFSGAFKPFKGDLVLVEYSMNSGMSNINIHSVSPLSCQDINEV 176

  Fly   237 FPTRIQEGEKCIVE-RVYVHMVVLGPETYILKTDLPTGTDLHLGDIVLADLIECQYSKFTRRAIK 300
            :.|.| :|...:|| ||:..:..|         .:|:|....|.|||....::......:.||:.
  Rat   177 YVTSI-DGRNGMVEARVFFTLDSL---------QIPSGYTPGLYDIVDVVTVDSIQQHCSLRAVS 231

  Fly   301 ITPLE 305
            :||::
  Rat   232 VTPVQ 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
armiNP_001014556.1 AAA_11 698..902 CDD:289831
AAA_19 720..768 CDD:289986
DNA2 <840..1155 CDD:224037
UvrD_C_2 909..1132 CDD:304668
LOC100360296XP_008771545.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335117
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.