DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sty and spry1

DIOPT Version :9

Sequence 1:NP_523902.2 Gene:sty / 38424 FlyBaseID:FBgn0014388 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_001116072.1 Gene:spry1 / 798229 ZFINID:ZDB-GENE-081215-2 Length:292 Species:Danio rerio


Alignment Length:332 Identity:93/332 - (28%)
Similarity:135/332 - (40%) Gaps:85/332 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 PASPVTLAQPRPESERLTNEYVDTPLQHATRSQHPAGQQDNGQTTTHHLLLLPQRNQHLHLQQHQ 245
            |.:.::|.|.:  :.|..|||.:.|......:..|..               |.|:.|.|.:.|:
Zfish    12 PGAVLSLDQIK--AIRSNNEYTEGPAVPRRPAPGPPP---------------PPRHAHKHERTHE 59

  Fly   246 QHLQQQQQQQQQQQQQQHLQHQQNQQHARLATTTQATSVGSDHTD-------GLLH---SHLQNS 300
            ..|.......:          .|:....|....:::||.||..:.       |||.   .|.:||
Zfish    60 VILVNVNNNYE----------PQSSLLVRPPGLSRSTSTGSSESSSSAGSELGLLSRTPQHHRNS 114

  Fly   301 TTKPPASKQPAPPRLGMGLGLGLGLGLNQPIITKQPTPATQKERMHALEELLQPGGAGGNGGPLV 365
            ....|.|                   ||.|.:   |..|..|: |||                  
Zfish   115 VRTQPKS-------------------LNAPFL---PPDAPLKQ-MHA------------------ 138

  Fly   366 MAGDPSLLNPIVCPRCGRCRCEQCQSPRPLPQTWVCNKTCLCSAESVIDYASCLCCAKALFYHCA 430
            .:.|.:.|  .:|..||:|:|.:|.:||.||....||..||||||:||:..:|:|..|.:||||:
Zfish   139 DSRDSAHL--YICESCGKCKCSECTAPRALPARLACNGLCLCSAENVIEQGTCMCLVKGIFYHCS 201

  Fly   431 RDNDLDCDDGNGTPCVDNPCSCGPYKRTQRWGWLGALSIFLPCLWFYWPMRGCMKLCEKCYGRFA 495
            :|     ||..|..|.|.|||....:...|:..:|.::...|||..|.|.:||:|.|..|:.|..
Zfish   202 KD-----DDDVGDACADRPCSLSHPQCCSRFLCMGLMATLFPCLLCYLPAKGCVKACNSCHDRLT 261

  Fly   496 GRGCRCQ 502
            ..||||:
Zfish   262 RPGCRCK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
styNP_523902.2 Sprouty 384..488 CDD:282994 43/103 (42%)
spry1NP_001116072.1 Sprouty 155..253 CDD:282994 43/102 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578187
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I4302
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1157681at2759
OrthoFinder 1 1.000 - - FOG0001173
OrthoInspector 1 1.000 - - otm24615
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12365
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X723
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.