DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sty and RGD1564382

DIOPT Version :9

Sequence 1:NP_523902.2 Gene:sty / 38424 FlyBaseID:FBgn0014388 Length:589 Species:Drosophila melanogaster
Sequence 2:XP_008756942.3 Gene:RGD1564382 / 498683 RGDID:1564382 Length:221 Species:Rattus norvegicus


Alignment Length:174 Identity:76/174 - (43%)
Similarity:101/174 - (58%) Gaps:16/174 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 IITKQPTPATQKE--RMHALEELLQPGGAGGNGGPLVMAGDPSLLNPIVCPRCGRCRCEQCQSPR 393
            :.|..|:|:....  |.|...:....|||..:.|   .:.|..|   .:|..||||:|..|.:.|
  Rat    37 LATMTPSPSGPSSILRTHPKVDGALKGGAEQSAG---QSSDHRL---FICEECGRCKCVPCTAVR 95

  Fly   394 PLPQTWVCNKTCLCSAESVIDYASCLCCAKALFYHCARDNDLDCDDGNGTPCVDNPCSCGPYKRT 458
            |||..||||:.|||||||::||.:||||.:.:||||:.|     |:.|   |.|.||||||..|.
  Rat    96 PLPSCWVCNQRCLCSAESLLDYGTCLCCVQGVFYHCSTD-----DEDN---CADEPCSCGPGSRF 152

  Fly   459 QRWGWLGALSIFLPCLWFYWPMRGCMKLCEKCYGRFAGRGCRCQ 502
            .||..:|.:|:|||||..|.|.|||::||::.|......||||:
  Rat   153 LRWAAMGVISVFLPCLCCYLPTRGCLRLCQRGYDSLRRPGCRCK 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
styNP_523902.2 Sprouty 384..488 CDD:282994 55/103 (53%)
RGD1564382XP_008756942.3 Sprouty 85..186 CDD:398746 57/108 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1157681at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.