DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sty and Spry3

DIOPT Version :9

Sequence 1:NP_523902.2 Gene:sty / 38424 FlyBaseID:FBgn0014388 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_001102533.1 Gene:Spry3 / 498159 RGDID:1562172 Length:281 Species:Rattus norvegicus


Alignment Length:328 Identity:109/328 - (33%)
Similarity:144/328 - (43%) Gaps:83/328 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 PASPVTLAQPRPESERLTNEYVDTPLQHATRSQHPAGQQDNGQTTTHHLLLLPQRNQHLHLQQHQ 245
            |...:.:||.|  |...:|:|||.|         ||.::..        |..|.    |.||.|:
  Rat     6 PQPILPIAQLR--SVHASNDYVDRP---------PAPRKPT--------LSSPS----LTLQTHK 47

  Fly   246 QHLQQQQQQQQQQQQQQHLQHQQNQQHARLATTTQA--TSVGSDHTDGLLHSHLQNSTTKPPASK 308
            ....                         ||||..|  .||...|....|..||..|:.....|:
  Rat    48 SDWS-------------------------LATTPTALPRSVSQCHQLQPLPQHLSQSSIASSVSQ 87

  Fly   309 --QPAPPRLGMGLGLGLGLGLNQPIITKQPTPATQKE--RMHALEELLQPGGAGGNGGPLVMAGD 369
              ..:..||               :.|..|:|:....  |.|...:....|||..:.|   .:.|
  Rat    88 TTTASDQRL---------------LATMTPSPSGPSSILRTHPKVDGALKGGAEQSAG---QSSD 134

  Fly   370 PSLLNPIVCPRCGRCRCEQCQSPRPLPQTWVCNKTCLCSAESVIDYASCLCCAKALFYHCARDND 434
            ..|   .:|..||||:|..|.:.||||..||||:.|||||||::||.:||||.:.:||||:.|  
  Rat   135 HRL---FICEECGRCKCVPCTAVRPLPSCWVCNQRCLCSAESLLDYGTCLCCVQGVFYHCSTD-- 194

  Fly   435 LDCDDGNGTPCVDNPCSCGPYKRTQRWGWLGALSIFLPCLWFYWPMRGCMKLCEKCYGRFAGRGC 499
               |:.|   |.|.||||||..|..||..:|.:|:|||||..|.|.|||::||::.|......||
  Rat   195 ---DEDN---CADEPCSCGPGSRFLRWAAMGVISVFLPCLCCYLPTRGCLRLCQRGYDSLRRPGC 253

  Fly   500 RCQ 502
            ||:
  Rat   254 RCK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
styNP_523902.2 Sprouty 384..488 CDD:282994 55/103 (53%)
Spry3NP_001102533.1 Sprouty 145..246 CDD:398746 57/108 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338638
Domainoid 1 1.000 148 1.000 Domainoid score I4332
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1157681at2759
OrthoFinder 1 1.000 - - FOG0001173
OrthoInspector 1 1.000 - - otm45991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12365
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X723
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.950

Return to query results.
Submit another query.