DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sty and Spry1

DIOPT Version :9

Sequence 1:NP_523902.2 Gene:sty / 38424 FlyBaseID:FBgn0014388 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_001382001.1 Gene:Spry1 / 294981 RGDID:1309293 Length:313 Species:Rattus norvegicus


Alignment Length:349 Identity:98/349 - (28%)
Similarity:149/349 - (42%) Gaps:98/349 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 QPPA-------------SPVT-LAQPRPESERLTNEYVDTPLQHATRSQHPAGQQDNGQTTTHHL 229
            ||||             .|.| |:..:.::.|.:|||.:.| ..|.|.......:...|..||.:
  Rat    17 QPPAVEGRQRLDYDRDTQPATILSLDQIKAIRGSNEYTEGP-SVARRPAPRTAPRPEKQERTHEI 80

  Fly   230 LLLPQRNQHLHLQQHQQHLQQQQQQQQQQQQQQHLQHQQNQQHARLATTTQATSVGSDHTDGLLH 294
            :.....:.::|                     :...|..|   ||.:..:::||.||..:.|   
  Rat    81 IPANVNSSYVH---------------------RPAGHSGN---ARGSVLSRSTSTGSAASSG--- 118

  Fly   295 SHLQNSTTKPPASKQPAPPRLGMGLGLGLGLGLNQP-----------IITKQPTPATQKERMHAL 348
                  ::...:|:|            || ||.:.|           :|..||......:...:|
  Rat   119 ------SSSSVSSEQ------------GL-LGRSPPTRPIPGHRSDRVIRTQPKQLLVDDLKASL 164

  Fly   349 EELLQPGGAGGNGGPLVMAGDPSLLNPIVCPRCGRCRCEQCQSPRPLPQTWVCNKTCLCSAESVI 413
            :|                  ||: .:..:|.:||:|:|.:|.:||.||....|::.|||||||::
  Rat   165 KE------------------DPT-QHKFICEQCGKCKCGECTAPRALPSCLACDRQCLCSAESMV 210

  Fly   414 DYASCLCCAKALFYHCARDNDLDCDDGNGTPCVDNPCSCGPYKRTQRWGWLGALSIFLPCLWFYW 478
            :|.:|:|..|.:||||:.|:|       |....||||||.......|:..:||||:.||||..|.
  Rat   211 EYGTCMCLVKGIFYHCSNDDD-------GGSYSDNPCSCSQSHCCSRYLCMGALSLCLPCLLCYP 268

  Fly   479 PMRGCMKLCEKCYGRFAGRGCRCQ 502
            |.:||:|||..||......||||:
  Rat   269 PAKGCLKLCRGCYDWTHRPGCRCR 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
styNP_523902.2 Sprouty 384..488 CDD:282994 47/103 (46%)
Spry1NP_001382001.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338641
Domainoid 1 1.000 148 1.000 Domainoid score I4332
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001173
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12365
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X723
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.