DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sty and Spry1

DIOPT Version :9

Sequence 1:NP_523902.2 Gene:sty / 38424 FlyBaseID:FBgn0014388 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_001292369.1 Gene:Spry1 / 24063 MGIID:1345139 Length:313 Species:Mus musculus


Alignment Length:403 Identity:105/403 - (26%)
Similarity:159/403 - (39%) Gaps:139/403 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 SGSVSGSSSSFTRRRPPAPVPLNNSISNNNNNSINNNFLSHFQSAEPA-------------SNAL 177
            |.|..||.:|....:|||       :.....       |.:.:..:||             ||..
Mouse     3 SPSQHGSHTSLVVIQPPA-------VEGRQR-------LDYDRDTQPATILSLDQIKAIRGSNEY 53

  Fly   178 GQPPA---SPVTLAQPRPESERLTNEY----VDTPLQHATRSQHPAGQQDNGQTTTHHLLLLPQR 235
            .:.|:   .|.....||||.:..|:|.    |::..:|...| ||.                   
Mouse    54 TEGPSVARRPAPRTAPRPEKQERTHEIIPANVNSSYEHRPAS-HPG------------------- 98

  Fly   236 NQHLHLQQHQQHLQQQQQQQQQQQQQQHLQHQQNQQHARLATTTQATSVGSDHTDGLLHSHLQNS 300
                                                :||.:..:::||.||..:.|         
Mouse    99 ------------------------------------NARGSVLSRSTSTGSAASSG--------- 118

  Fly   301 TTKPPASKQPAPPRLGMGLGLGLGLGLNQPIITKQPTPATQKERM------HALEELLQPGGAGG 359
            ::...:|:|            || ||.:.|   .:|.|..:.:|:      ..|.|.|:..    
Mouse   119 SSSSVSSEQ------------GL-LGRSPP---TRPIPGHRSDRVIRTQPKQLLVEDLKAS---- 163

  Fly   360 NGGPLVMAGDPSLLNPIVCPRCGRCRCEQCQSPRPLPQTWVCNKTCLCSAESVIDYASCLCCAKA 424
                  :..||: .:..:|.:||:|:|.:|.:||.||....|::.|||||||:::|.:|:|..|.
Mouse   164 ------LKEDPT-QHKFICEQCGKCKCGECTAPRALPSCLACDRQCLCSAESMVEYGTCMCLVKG 221

  Fly   425 LFYHCARDNDLDCDDGNGTPCVDNPCSCGPYKRTQRWGWLGALSIFLPCLWFYWPMRGCMKLCEK 489
            :||||:.|:|       |....||||||.......|:..:||||:.||||..|.|.:||:|||..
Mouse   222 IFYHCSNDDD-------GGSYSDNPCSCSQSHCCSRYLCMGALSLCLPCLLCYPPAKGCLKLCRG 279

  Fly   490 CYGRFAGRGCRCQ 502
            ||......||||:
Mouse   280 CYDWTHRPGCRCR 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
styNP_523902.2 Sprouty 384..488 CDD:282994 47/103 (46%)
Spry1NP_001292369.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..152 32/189 (17%)
Sprouty 181..278 CDD:368340 47/103 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835046
Domainoid 1 1.000 148 1.000 Domainoid score I4440
eggNOG 1 0.900 - - E1_2CAWB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001173
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12365
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X723
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.800

Return to query results.
Submit another query.