DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sty and Spry3

DIOPT Version :9

Sequence 1:NP_523902.2 Gene:sty / 38424 FlyBaseID:FBgn0014388 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_001025464.1 Gene:Spry3 / 236576 MGIID:1345188 Length:288 Species:Mus musculus


Alignment Length:325 Identity:99/325 - (30%)
Similarity:131/325 - (40%) Gaps:97/325 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 SERLTNEYVD---TPLQHATRSQHPAGQQDNGQTTTHHL-LLLPQRNQHLH-LQQHQQHLQQQQQ 253
            |...:|:||:   .|.:.|..|.....|......:...: ..||:.....| ||...|||.|.. 
Mouse    20 STHASNDYVERPPAPCKQALSSPSLIVQTHKSDWSLATMPTALPRSISQCHQLQPLPQHLSQSS- 83

  Fly   254 QQQQQQQQQHLQHQQNQQHARLATTTQATSVGSDHTDGLLHSHLQNSTTKPP----ASKQPAPPR 314
                                                   :.|.:..|||...    ||..|:|. 
Mouse    84 ---------------------------------------ISSSMSQSTTASDQRLLASITPSPS- 108

  Fly   315 LGMGLGLGLGLGLNQPIITKQPTPATQKERMHALEELLQPGGAGGN---GGPLVMAGDPSLLNP- 375
                         .|.||..||                   |||.:   .|.|....:.|:.:. 
Mouse   109 -------------GQSIIRTQP-------------------GAGAHPKVDGALKGEAEQSVGHSS 141

  Fly   376 ---IVCPRCGRCRCEQCQSPRPLPQTWVCNKTCLCSAESVIDYASCLCCAKALFYHCARDNDLDC 437
               .:|..||||:|..|.:.||||..|:||:.|||||||::||.:||||.|.|||||:.|     
Mouse   142 DHLFICEECGRCKCVPCTAVRPLPSCWMCNQRCLCSAESLLDYGTCLCCVKGLFYHCSTD----- 201

  Fly   438 DDGNGTPCVDNPCSCGPYKRTQRWGWLGALSIFLPCLWFYWPMRGCMKLCEKCYGRFAGRGCRCQ 502
            |:.|   |.|.||||||.....||..:..:|:|||||..|.|.|||:.:|::.|......||||:
Mouse   202 DEDN---CADEPCSCGPSSCFIRWAAMSLISLFLPCLCCYLPTRGCLHMCQQGYDSLRRPGCRCK 263

  Fly   503  502
            Mouse   264  263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
styNP_523902.2 Sprouty 384..488 CDD:282994 53/103 (51%)
Spry3NP_001025464.1 Sprouty 152..253 CDD:398746 55/108 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4440
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 186 1.000 Inparanoid score I3912
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1157681at2759
OrthoFinder 1 1.000 - - FOG0001173
OrthoInspector 1 1.000 - - otm43903
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X723
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.