DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sty and crm-1

DIOPT Version :9

Sequence 1:NP_523902.2 Gene:sty / 38424 FlyBaseID:FBgn0014388 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_741616.2 Gene:crm-1 / 179439 WormBaseID:WBGene00007103 Length:966 Species:Caenorhabditis elegans


Alignment Length:125 Identity:34/125 - (27%)
Similarity:48/125 - (38%) Gaps:30/125 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 KERMH--ALEELLQPGGAGGNGGPLVM-AGDPS-----LLNPI---VCPRCGRCRCEQCQSPRPL 395
            |||||  .|:.:.          |||. .|.||     .::|.   .||..|.|.|:|   .:.:
 Worm    89 KERMHDDCLKAIC----------PLVFHKGCPSDSQLITVSPAPGNCCPPPGSCHCDQ---KKCV 140

  Fly   396 PQTWVCNK-TCLCSAESVIDYASCLCCAKALFYHCARDNDLDCDDGNGTPCVDNPCSCGP 454
            |....|.| ..|...|...|... .|||   :|.|.: .:..|::.:..|...:...|.|
 Worm   141 PSVPTCTKEERLVMVEKGSDIPG-KCCA---YYECHK-KEKKCENVHCPPMFQDEEECPP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
styNP_523902.2 Sprouty 384..488 CDD:282994 18/72 (25%)
crm-1NP_741616.2 IGFBP 28..76 CDD:278641
VWC 263..319 CDD:302663
VWC 333..377 CDD:302663
VWC 607..658 CDD:302663
VWC 681..734 CDD:302663
VWC 744..797 CDD:302663
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.928771 Normalized mean entropy S2
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.