DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sty and SPRY1

DIOPT Version :9

Sequence 1:NP_523902.2 Gene:sty / 38424 FlyBaseID:FBgn0014388 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_001244967.1 Gene:SPRY1 / 10252 HGNCID:11269 Length:319 Species:Homo sapiens


Alignment Length:326 Identity:98/326 - (30%)
Similarity:152/326 - (46%) Gaps:63/326 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 QPPASPVTLAQPRPESERLTNEYVDTPLQHATRSQHPAGQQDNGQTTTHHLLLLPQRNQHLHLQQ 243
            ||.|   .|:..:.::.|.:|||.:.|......:...|.:|:..: .||.::.:...|.:.|   
Human    34 QPTA---ILSLDQIKAIRGSNEYTEGPSVVKRPAPRTAPRQEKHE-RTHEIIPINVNNNYEH--- 91

  Fly   244 HQQHLQQQQQQQQQQQQQQHLQHQQNQQHARLATTTQATSVGSDHTDGLLHSHLQNSTTKPPASK 308
                           :...||.|.....:||....:::||.||..:.|      .||:.   :|:
Human    92 ---------------RHTSHLGHAVLPSNARGPILSRSTSTGSAASSG------SNSSA---SSE 132

  Fly   309 QPAPPRLGMGLGLGLGLGLNQPIITKQPTPATQKERMHALE--ELLQPGGAGGNGGPLVMAGDPS 371
            |            || ||.:.|   .:|.|..:.||....:  :|:.....|.....|..     
Human   133 Q------------GL-LGRSPP---TRPVPGHRSERAIRTQPKQLIVDDLKGSLKEDLTQ----- 176

  Fly   372 LLNPIVCPRCGRCRCEQCQSPRPLPQTWVCNKTCLCSAESVIDYASCLCCAKALFYHCARDNDLD 436
              :..:|.:||:|:|.:|.:||.||....||:.|||||||:::|.:|:|..|.:||||:.|::  
Human   177 --HKFICEQCGKCKCGECTAPRTLPSCLACNRQCLCSAESMVEYGTCMCLVKGIFYHCSNDDE-- 237

  Fly   437 CDDGNGTPCVDNPCSCGPYKRTQRWGWLGALSIFLPCLWFYWPMRGCMKLCEKCYGRFAGRGCRC 501
                 |....||||||.......|:..:||:|:|||||..|.|.:||:|||.:||......||||
Human   238 -----GDSYSDNPCSCSQSHCCSRYLCMGAMSLFLPCLLCYPPAKGCLKLCRRCYDWIHRPGCRC 297

  Fly   502 Q 502
            :
Human   298 K 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
styNP_523902.2 Sprouty 384..488 CDD:282994 47/103 (46%)
SPRY1NP_001244967.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 54..78 3/24 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..160 20/84 (24%)
Sprouty 187..284 CDD:368340 47/103 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144943
Domainoid 1 1.000 148 1.000 Domainoid score I4467
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I3918
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1157681at2759
OrthoFinder 1 1.000 - - FOG0001173
OrthoInspector 1 1.000 - - otm41854
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12365
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X723
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.960

Return to query results.
Submit another query.