DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sty and SPRY3

DIOPT Version :9

Sequence 1:NP_523902.2 Gene:sty / 38424 FlyBaseID:FBgn0014388 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_001291919.1 Gene:SPRY3 / 10251 HGNCID:11271 Length:288 Species:Homo sapiens


Alignment Length:310 Identity:102/310 - (32%)
Similarity:137/310 - (44%) Gaps:67/310 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 SERLTNEYVDTPLQHATRSQHPAGQQDNGQTTTHHLLLLPQRNQHLHLQQHQQHLQQQQQQ-QQQ 257
            |...:|:||:.|         ||..:   |..:...|::........|......|.:...| .|.
Human    20 STHASNDYVERP---------PAPCK---QALSSPSLIVQTHKSDWSLATMPTSLPRSLSQCHQL 72

  Fly   258 QQQQQHLQHQQNQQHARLATTTQATSVGSDHTDGLLHSHLQNSTTKPPASKQPAPPRLGMGLGLG 322
            |...|||      ..:.:|::...::..||..  ||            ||..|:|.         
Human    73 QPLPQHL------SQSSIASSMSHSTTASDQR--LL------------ASITPSPS--------- 108

  Fly   323 LGLGLNQPIITKQPTPATQKERMHALEELLQPGGAGGNGGPLVMAGDPSLLNPIVCPRCGRCRCE 387
                 .|.||..||......:...||:           |.....||.|| .:..:|..||||:|.
Human   109 -----GQSIIRTQPGAGVHPKADGALK-----------GEAEQSAGHPS-EHLFICEECGRCKCV 156

  Fly   388 QCQSPRPLPQTWVCNKTCLCSAESVIDYASCLCCAKALFYHCARDNDLDCDDGNGTPCVDNPCSC 452
            .|.:.||||..|:||:.|||||||::||.:||||.|.|||||:.|     |:.|   |.|.||||
Human   157 PCTAARPLPSCWLCNQRCLCSAESLLDYGTCLCCVKGLFYHCSTD-----DEDN---CADEPCSC 213

  Fly   453 GPYKRTQRWGWLGALSIFLPCLWFYWPMRGCMKLCEKCYGRFAGRGCRCQ 502
            ||.....||..:..:|:|||||..|.|.|||:.||::.|......||||:
Human   214 GPSSCFVRWAAMSLISLFLPCLCCYLPTRGCLHLCQQGYDSLRRPGCRCK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
styNP_523902.2 Sprouty 384..488 CDD:282994 54/103 (52%)
SPRY3NP_001291919.1 Sprouty 152..253 CDD:398746 56/108 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144944
Domainoid 1 1.000 148 1.000 Domainoid score I4467
eggNOG 1 0.900 - - E1_2CAWB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I3918
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1157681at2759
OrthoFinder 1 1.000 - - FOG0001173
OrthoInspector 1 1.000 - - otm41854
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12365
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X723
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.860

Return to query results.
Submit another query.