DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sty and spry4

DIOPT Version :9

Sequence 1:NP_523902.2 Gene:sty / 38424 FlyBaseID:FBgn0014388 Length:589 Species:Drosophila melanogaster
Sequence 2:XP_002939581.1 Gene:spry4 / 100498065 XenbaseID:XB-GENE-480765 Length:297 Species:Xenopus tropicalis


Alignment Length:321 Identity:93/321 - (28%)
Similarity:144/321 - (44%) Gaps:79/321 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 PVT-LAQPRPESERLTNEYVDTP-LQHATRSQHPAGQQDNGQTTTHHLLLLPQRNQHLHLQQHQQ 246
            |:| |...:.::..|.|:|:|.| |......:...|        .|...|:   ||||       
 Frog    34 PLTILPIDQMKTSHLENDYIDNPSLSQLANQKLVRG--------PHEPTLI---NQHL------- 80

  Fly   247 HLQQQQQQQQQQQQQQHLQHQQNQQHARLATTTQATSVGSDHTDGLLHSHLQNSTTKPPASKQPA 311
                       |:.:..:.|.......|.::.:.::|..||..   |..|:     .||.....:
 Frog    81 -----------QRCEADITHPWISFSGRPSSISSSSSTSSDQR---LLDHM-----APPPVVDQS 126

  Fly   312 PPRLGMGLGLGLGLGLNQPIITKQPTPATQKERMHALEELLQPGGAGGNGGPLVMAGDPSLLNPI 376
            |||         .:.:...:|..:|....                     ||:....|...|   
 Frog   127 PPR---------AVRIQPKVINCKPQDVK---------------------GPMAQELDKHFL--- 158

  Fly   377 VCPRCGRCRCEQCQSPRPLPQTWVCNKTCLCSAESVIDYASCLCCAKALFYHCARDNDLDCDDGN 441
            :|..||:|:|:.|.:||.||..||||:.|||||:::::|::|:|..|.:||||..::    |:|:
 Frog   159 LCEACGKCKCKDCTTPRTLPSCWVCNQECLCSAQNLVNYSTCMCLVKGVFYHCTNED----DEGS 219

  Fly   442 GTPCVDNPCSCGPYKRTQRWGWLGALSIFLPCLWFYWPMRGCMKLCEKCYGRFAGRGCRCQ 502
               |.|:||||.......||.::||||:.||||..|.|..||:||.:|||.:.:..||||:
 Frog   220 ---CADHPCSCSHSNCCARWSFMGALSLVLPCLLCYLPATGCVKLSQKCYDQASRPGCRCK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
styNP_523902.2 Sprouty 384..488 CDD:282994 48/103 (47%)
spry4XP_002939581.1 Sprouty 165..267 CDD:398746 50/108 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4607
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I4048
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1157681at2759
OrthoFinder 1 1.000 - - FOG0001173
OrthoInspector 1 1.000 - - otm49075
Panther 1 1.100 - - O PTHR12365
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4768
SonicParanoid 1 1.000 - - X723
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.100

Return to query results.
Submit another query.