DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ids and STS

DIOPT Version :9

Sequence 1:NP_647814.1 Gene:Ids / 38423 FlyBaseID:FBgn0035445 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001307679.1 Gene:STS / 412 HGNCID:11425 Length:590 Species:Homo sapiens


Alignment Length:526 Identity:123/526 - (23%)
Similarity:201/526 - (38%) Gaps:135/526 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLSLMMPVLLDAAAPPRRPNVVMVIFDDL---RPVIGAYGDTLASTPYLDNFARGSHIFTRVYS 67
            |||..:......||:   |||:::|:.|||   .|  |.||:....||.:|..|.|....|:..:
Human    18 LLLFFLWEAESHAAS---RPNIILVMADDLGIGDP--GCYGNKTIRTPNIDRLASGGVKLTQHLA 77

  Fly    68 QQSLCAPSRNSLLTGRRPDTLHLYDFYSYWRT----FTGNFTTLP-------QYFKEHGYYTYSC 121
            ...||.|||.:.:|||.|....:   .|:.||    ||.:...||       :..|:.||.|...
Human    78 ASPLCTPSRAAFMTGRYPVRSGM---ASWSRTGVFLFTASSGGLPTDEITFAKLLKDQGYSTALI 139

  Fly   122 GKVFHPGLSSNNTDDY---PLSWSAPAFRPRTEQFMNSPVCPDKEGIL-----RKNLICPVELQT 178
            || :|.|:|.::..|:   ||......|...:  ..|...|...||.:     ::.:..|:::..
Human   140 GK-WHLGMSCHSKTDFCHHPLHHGFNYFYGIS--LTNLRDCKPGEGSVFTTGFKRLVFLPLQIVG 201

  Fly   179 QPYKTLPDIE---------SVAEALRFVGSRSRHSQEPFFLAMGF---HKP-----HINFRFPRQ 226
            ....||..:.         .|..:|.|:.:..      ..|.:||   .:|     ..|:...:|
Human   202 VTLLTLAALNCLGLLHVPLGVFFSLLFLAALI------LTLFLGFLHYFRPLNCFMMRNYEIIQQ 260

  Fly   227 FLSRFNLSQ-----FYNYTEDSLKPPDMPAVAW-NPYTDVRARDDFKHSNISFPYGPISPLQAAQ 285
            .:|..||:|     ...:.:.:.:.|.:..::: :.:|.:.:..||...:....||.        
Human   261 PMSYDNLTQRLTVEAAQFIQRNTETPFLLVLSYLHVHTALFSSKDFAGKSQHGVYGD-------- 317

  Fly   286 IRQSYYASVSYVDDLFGKLIGGLD----LDETVVVALGD--------------HGWSLGEHAEWA 332
                   :|..:|...|:::..||    .::|::....|              ||.|.|.: :..
Human   318 -------AVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEVSSKGEIHGGSNGIY-KGG 374

  Fly   333 KYSNFEVALRVPLIIRSPQFPVAQTKYYHGITELLDVFPTLVDLAGLPKLDKCQSSQELTCGEGK 397
            |.:|:|..:|||.|:|.|:...|..|.... |..:|:|||:..|||.|       ..|....:|:
Human   375 KANNWEGGIRVPGILRWPRVIQAGQKIDEP-TSNMDIFPTVAKLAGAP-------LPEDRIIDGR 431

  Fly   398 SLYHQLMGLGRADEHVALSQYPRPGMLPTKHPNSDKPKLRNIKIMGYSLRTDIYRYTMWVRFHAQ 462
            .|...|.|..:..:|..|..|                               ...|...||:|.|
Human   432 DLMPLLEGKSQRSDHEFLFHY-------------------------------CNAYLNAVRWHPQ 465

  Fly   463 NFSRDW 468
            |.:..|
Human   466 NSTSIW 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IdsNP_647814.1 AslA 21..509 CDD:225661 118/511 (23%)
iduronate-2-sulfatase 24..495 CDD:293754 118/508 (23%)
STSNP_001307679.1 AslA 30..555 CDD:225661 120/514 (23%)
ES 33..557 CDD:293778 118/508 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5833
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.