DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12012 and Bri3

DIOPT Version :9

Sequence 1:NP_001286929.1 Gene:CG12012 / 38422 FlyBaseID:FBgn0035444 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_061242.3 Gene:Bri3 / 55950 MGIID:1933174 Length:125 Species:Mus musculus


Alignment Length:126 Identity:49/126 - (38%)
Similarity:60/126 - (47%) Gaps:25/126 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PPSYEEVMNSPSQDSRLIVGVH-QGA-PSAPP-----------PNMHMPTYGAFETTPVSVVIQP 61
            ||:|    |..:.......|.| .|| |:|||           |..|...|.....|   |...|
Mouse    11 PPAY----NLEAGQGDYACGPHGYGAIPTAPPPPPYPYLVTGIPTSHPRVYNIHSRT---VTRYP 68

  Fly    62 APVAMPTEIIVIGGCPACRIGYLEDTFSACGLCCAIFFFPLGILCCLAMREKRCSNCGTVF 122
            |     ..|:|:||||.||:|.||..|:..|:..||..||.|.|||.|:|::||.|||.||
Mouse    69 A-----NSIVVVGGCPVCRVGVLEYCFTCLGIFLAIVLFPFGFLCCFALRKRRCPNCGAVF 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12012NP_001286929.1 DUF2367 31..122 CDD:401972 42/103 (41%)
Bri3NP_061242.3 DUF2367 29..124 CDD:401972 41/102 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833842
Domainoid 1 1.000 76 1.000 Domainoid score I9012
eggNOG 1 0.900 - - E1_KOG4517
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5231
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008415
OrthoInspector 1 1.000 - - oto92527
orthoMCL 1 0.900 - - OOG6_108570
Panther 1 1.100 - - LDO PTHR13551
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5037
SonicParanoid 1 1.000 - - X6407
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.780

Return to query results.
Submit another query.