DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12012 and F11G11.5

DIOPT Version :9

Sequence 1:NP_001286929.1 Gene:CG12012 / 38422 FlyBaseID:FBgn0035444 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001367752.1 Gene:F11G11.5 / 173836 WormBaseID:WBGene00017385 Length:223 Species:Caenorhabditis elegans


Alignment Length:132 Identity:39/132 - (29%)
Similarity:54/132 - (40%) Gaps:23/132 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DAAPPSYEEVMNSP-------SQDSRLIVGVHQGAPSA--PPPNM---HMPTYGAFETTPVSVVI 59
            |..||||:..|:.|       |.|.:...|   |.|..  .||.:   .:|...|.|....:|.|
 Worm    91 DMPPPSYQAAMSYPAAPTYGGSTDPKYHNG---GQPPIYYQPPQITQTRLPQPAAIEQIVRAVRI 152

  Fly    60 Q-PAPVAMPTEIIVIGGCPACRIGYLEDTFSACGLCC----AIFFFPLGI--LCCLAMR-EKRCS 116
            | ||...:...:.....|..|.:|.:......|.|.|    .||.||.|:  |||:... :.||:
 Worm   153 QNPAGSNVIVHVQPGAPCRRCTVGVITRQTDMCCLLCLIMLTIFTFPFGLIFLCCVPCTVQNRCT 217

  Fly   117 NC 118
            :|
 Worm   218 HC 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12012NP_001286929.1 DUF2367 31..122 CDD:401972 29/101 (29%)
F11G11.5NP_001367752.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157728
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13551
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.