DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12012 and bri3

DIOPT Version :9

Sequence 1:NP_001286929.1 Gene:CG12012 / 38422 FlyBaseID:FBgn0035444 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001116284.1 Gene:bri3 / 100144285 XenbaseID:XB-GENE-949087 Length:134 Species:Xenopus tropicalis


Alignment Length:127 Identity:52/127 - (40%)
Similarity:72/127 - (56%) Gaps:18/127 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PPSYEEVMNSPSQDSRLIVGVHQGAPSA-------PPPNMHMPTYG-------AFETTPVSVVIQ 60
            ||:|...:.......:...|...|||..       |||..:.|..|       |:.:| .:::.|
 Frog    11 PPAYSPAVPGGYDYGQQNYGTIPGAPQTAAQPAFQPPPYPYPPGAGFVPPSQPAYPST-YTIIQQ 74

  Fly    61 PAPVAMPTEIIVIGGCPACRIGYLEDTFSACGLCCAIFFFPLGILCCLAMREKRCSNCGTVF 122
            ||..   |.::|:|||||||:|.|||:|:..||.|||||||:|||.|:|:|::||.|||..|
 Frog    75 PAAT---TSVVVVGGCPACRVGVLEDSFTCLGLFCAIFFFPIGILFCMALRQRRCPNCGATF 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12012NP_001286929.1 DUF2367 31..122 CDD:401972 47/104 (45%)
bri3NP_001116284.1 DUF2367 28..133 CDD:370845 48/108 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 93 1.000 Domainoid score I7467
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I4884
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1433992at2759
OrthoFinder 1 1.000 - - FOG0008415
OrthoInspector 1 1.000 - - oto102829
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5037
SonicParanoid 1 1.000 - - X6407
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.