DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12012 and bri3

DIOPT Version :9

Sequence 1:NP_001286929.1 Gene:CG12012 / 38422 FlyBaseID:FBgn0035444 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001186968.1 Gene:bri3 / 100002236 ZFINID:ZDB-GENE-030131-3038 Length:130 Species:Danio rerio


Alignment Length:120 Identity:52/120 - (43%)
Similarity:68/120 - (56%) Gaps:8/120 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PPSYEEVMNSPSQDSRLIVGVHQGA--PSAPPPNMHMPTYGA-FETTPVSVVIQPA----PVAMP 67
            ||:|..|.::....|....|.....  |.||||....|...: :...|.....|||    .:..|
Zfish    11 PPAYNTVPSAYDYGSIPAAGAPAAGFQPPAPPPYQGFPAAASGYPAAPAPAAAQPAFSTYTIVQP 75

  Fly    68 TEIIVIGGCPACRIGYLEDTFSACGLCCAIFFFPLGILCCLAMREKRCSNCGTVF 122
            : ::|:|||||||:|.|||.|:..|:.|||||||||||.|||:|::||.|||..|
Zfish    76 S-VVVVGGCPACRVGVLEDDFTCLGIMCAIFFFPLGILFCLALRQRRCPNCGATF 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12012NP_001286929.1 DUF2367 31..122 CDD:401972 45/97 (46%)
bri3NP_001186968.1 DUF2367 13..129 CDD:287173 49/116 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576557
Domainoid 1 1.000 91 1.000 Domainoid score I7742
eggNOG 1 0.900 - - E1_KOG4517
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4972
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1433992at2759
OrthoFinder 1 1.000 - - FOG0008415
OrthoInspector 1 1.000 - - oto40190
orthoMCL 1 0.900 - - OOG6_108570
Panther 1 1.100 - - LDO PTHR13551
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5037
SonicParanoid 1 1.000 - - X6407
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.