DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12010 and ATAD2B

DIOPT Version :9

Sequence 1:NP_728878.1 Gene:CG12010 / 38421 FlyBaseID:FBgn0035443 Length:717 Species:Drosophila melanogaster
Sequence 2:XP_011531220.1 Gene:ATAD2B / 54454 HGNCID:29230 Length:1511 Species:Homo sapiens


Alignment Length:476 Identity:135/476 - (28%)
Similarity:194/476 - (40%) Gaps:113/476 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 ETEEELRRIFQAAQTFKEKLRPLLPIVILIE----DLELLCPSTAVADAKNSSNSLRISAELYKL 323
            |.|||.|         ..||.||..|.|..:    |:|       |.:|:...|....:....|.
Human   257 EGEEEAR---------TSKLLPLEKISIESQEEDGDIE-------VEEAEGEENDRPYNLRQRKT 305

  Fly   324 LDALPRGIICLATSGVPDSLHEHARRRFVREVTINMPSEGQRRQLVEHLCEVHELNISQTLLEHI 388
            :|...          .|..:..|.::   ||.|               |.::|.   |.....||
Human   306 VDRYQ----------APPIVPAHQKK---RENT---------------LFDIHR---SPARRSHI 339

  Fly   389 ARNTQGYVIADLTLLLRRVQQQLLTKDDFDIEHIFLKSLSQTQ----PSASRSTD---------V 440
            .|.......:|.|           :.|:...|....||:::.:    |...|:.|         |
Human   340 RRKKHAIHSSDTT-----------SSDEERFERRKSKSMARARNRCLPMNFRAEDLASGILRERV 393

  Fly   441 RVSKMTAG-----------FEVIGGMEALKRTLQVSVLAGIRQSAAFARFGLSLPKGVLLYGPPG 494
            :|....|.           |:.|||:......|:..|:..:.....|.:|.:..|:|.|.|||||
Human   394 KVGASLADVDPMNIDKSVRFDSIGGLSHHIHALKEMVVFPLLYPEIFEKFKIQPPRGCLFYGPPG 458

  Fly   495 CAKTTVAKCLAKEAD-----MTFIATSAAEVYSPYVGCAERFISRIFDTARKNAPCLIFLDEIDS 554
            ..||.||:.||.|..     :.|.....|:..|.:||.:||.:..:||.|....|.:||.||||.
Human   459 TGKTLVARALANECSQGDKKVAFFMRKGADCLSKWVGESERQLRLLFDQAYLMRPSIIFFDEIDG 523

  Fly   555 LVGRRTVSSGGGGGQVQLRILSTLLTEMNGIVGGGSQQHILVVAATNRPDMIDDALLRPGRFDKL 619
            |...|:...    .|:...|:||||..|:|:...|   .|:|:.||||.|.||.||.||||||:.
Human   524 LAPVRSSRQ----DQIHSSIVSTLLALMDGLDNRG---EIVVIGATNRLDSIDPALRRPGRFDRE 581

  Fly   620 IHVPAPDEKSRLALLKLHSQRM-PFHENVFLQEIAARTDRYSGADLCNLCNEAAIEAFQR----- 678
            .....||:|:|..:|::|::.. |...:.||.|:|.:...|.|||:..||.|||:.|.:|     
Human   582 FLFNLPDQKARKHILQIHTRDWNPKLSDAFLGELAEKCVGYCGADIKALCTEAALIALRRRYPQI 646

  Fly   679 ---------DFKATEIELQDF 690
                     |..:..:..|||
Human   647 YASSHKLQLDVSSIVLSAQDF 667

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12010NP_728878.1 SpoVK 201..707 CDD:223540 135/476 (28%)
AAA 224..357 CDD:278434 22/97 (23%)
AAA 487..623 CDD:278434 58/140 (41%)
ATAD2BXP_011531220.1 AAA 447..588 CDD:214640 60/147 (41%)
AAA 452..586 CDD:278434 58/140 (41%)
COG5076 866..>1100 CDD:227408
Bromo_AAA 974..1085 CDD:99957
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.