Sequence 1: | NP_647811.2 | Gene: | Ythdc1 / 38420 | FlyBaseID: | FBgn0027616 | Length: | 721 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_010662.3 | Gene: | PHO92 / 851980 | SGDID: | S000002782 | Length: | 306 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 195 | Identity: | 49/195 - (25%) |
---|---|---|---|
Similarity: | 85/195 - (43%) | Gaps: | 38/195 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 236 HSQKGY--DYMTKLNYLFRDT---------------------------RFFLIKSNNSDNVQLSK 271
Fly 272 NKSVWATLPQNDANLNQAFKEARN---VLLIFSVNESGKFAGFARMAAPSRRDIPQVAWVLPPSI 333
Fly 334 SPKALGGVIELDWICRKELSFNATLHLHNTWNEGKPVKIGRDGQEIEPKIGGELCRLF-PEDEQI 397
Fly 398 397 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ythdc1 | NP_647811.2 | YTH | 254..392 | CDD:309322 | 41/168 (24%) |
PHO92 | NP_010662.3 | YTH | 155..291 | CDD:398013 | 39/140 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2345 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.940 |