DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ythdc1 and PHO92

DIOPT Version :9

Sequence 1:NP_647811.2 Gene:Ythdc1 / 38420 FlyBaseID:FBgn0027616 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_010662.3 Gene:PHO92 / 851980 SGDID:S000002782 Length:306 Species:Saccharomyces cerevisiae


Alignment Length:195 Identity:49/195 - (25%)
Similarity:85/195 - (43%) Gaps:38/195 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 HSQKGY--DYMTKLNYLFRDT---------------------------RFFLIKSNNSDNVQLSK 271
            :|...|  :|::|..||.:.|                           |||:|||::..:|:.|.
Yeast   108 NSNNNYYREYLSKPRYLQQSTKEQTFNEINKRKSAAIIPPWLNIPENSRFFVIKSSSLKHVKRSF 172

  Fly   272 NKSVWATLPQNDANLNQAFKEARN---VLLIFSVNESGKFAGFARMAAPSRRDIPQVAWVLPPSI 333
            ...:|::....:..|::|:|:..:   |.|.||:|.||:|.|.|.|.:..:.|:....|.     
Yeast   173 YNGIWSSTHFGNKRLSEAYKKLNSGAKVFLFFSINTSGRFCGVAEMVSDLKMDLDTSIWE----- 232

  Fly   334 SPKALGGVIELDWICRKELSFNATLHLHNTWNEGKPVKIGRDGQEIEPKIGGELCRLF-PEDEQI 397
            ..:..|...::.|:..::::..:........||.||:...||.|||...||..:..|| .:|..|
Yeast   233 DEQKYGKAFKVRWVIVRDINNRSLKRFLIPSNEMKPITHSRDTQEIPYSIGISIINLFKTQDSDI 297

  Fly   398  397
            Yeast   298  297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ythdc1NP_647811.2 YTH 254..392 CDD:309322 41/168 (24%)
PHO92NP_010662.3 YTH 155..291 CDD:398013 39/140 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2345
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.