DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ythdc1 and ythdf2

DIOPT Version :9

Sequence 1:NP_647811.2 Gene:Ythdc1 / 38420 FlyBaseID:FBgn0027616 Length:721 Species:Drosophila melanogaster
Sequence 2:XP_005158820.1 Gene:ythdf2 / 393220 ZFINID:ZDB-GENE-040426-948 Length:613 Species:Danio rerio


Alignment Length:502 Identity:118/502 - (23%)
Similarity:173/502 - (34%) Gaps:139/502 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRAARKQTLPMREMADLDAVHLGLDENEADIAEELQDFEFNTRSEASESNGGDSSDSEPSISSVS 66
            |.||.:.......|..||....||.....|:|.::         ..|...||       .:|.||
Zfish   170 PFAANEPLNKAVGMNSLDQGMAGLKIGAGDMAPKV---------VGSGLPGG-------PLSQVS 218

  Fly    67 TA-TSSLAGSSKRKT-------KKPAKQSPQPAVETKSSKSSAKNKAKREPTPEELNGGKKKKRT 123
            || |...|..:..||       .||||  |||.::||.....    ....|.|       .|...
Zfish   219 TAPTMPPASMAPAKTASWADIASKPAK--PQPKLKTKGGLGG----TNLPPPP-------IKHNM 270

  Fly   124 DSGT--------KKTTSSEASDKVKSKSPDTEDRQPSAKKSRTKIPSNANDSAG--HKSDLSEAE 178
            |.||        |.....:.|.....:.|:....||.|             :||  .:..||..:
Zfish   271 DIGTWDNKGNMPKPAAPQQTSLPTNGQPPNQSSPQPGA-------------TAGGVPQLPLSNGQ 322

  Fly   179 DEKPS-----------------LPTLESDSESSDSDSGTQ--HKRNGGNGGGNGRGKPSSKSSTP 224
            ...|:                 .|.|.....:|.....|:  ..||..||.|:..|.|   ..:|
Zfish   323 LVPPTGQLVQHPLPPGGQPGAVPPQLSQGPPASQPSQPTRWVPPRNRANGFGDAAGGP---GQSP 384

  Fly   225 EKDSVGGGT---------------HSHSQKGYDYMTKLNYLFRDTRFFLIKSNNSDNVQLSKNKS 274
            ....:||.|               ::::.|.:|:..|      ..|.|:|||.:.|::..|...:
Zfish   385 PNSGMGGITVPAEPHPVLEKLRMVNNYNPKDFDWNPK------HGRVFIIKSYSEDDIHRSIKYN 443

  Fly   275 VWATLPQNDANLNQAFKEARN---VLLIFSVNESGKFAGFARMAAPSRRDIPQVAWVLPPSISPK 336
            :|.:....:..|:.|::...|   :.|:||||.||.|.|.|.|.:|...:.....|      |..
Zfish   444 IWCSTEHGNKRLDAAYRSLANKGPLYLLFSVNGSGHFCGVAEMRSPVDYNTCAGVW------SQD 502

  Fly   337 ALGGVIELDWICRKELSFNATLHLHNTWNEGKPVKIGRDGQEIEPKIGGELCRLFPEDEQIELTP 401
            ...|..::.||..|::..:...|:....||.|||...||.||:            |.|:..::..
Zfish   503 KWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEV------------PLDKARQVLK 555

  Fly   402 ILKKSKETARVMRE--------------KGIHVIYKPPRS-LSSRGH 433
            |:...|.|..:..:              |.:.|....|.| .|||.|
Zfish   556 IIASYKHTTSIFDDFSHYEKRQEEEESVKKVEVQGSDPYSNNSSRSH 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ythdc1NP_647811.2 YTH 254..392 CDD:309322 39/140 (28%)
ythdf2XP_005158820.1 Med15 <173..>411 CDD:312941 61/282 (22%)
YTH 424..557 CDD:309322 41/150 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2345
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.