DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ythdc1 and mmi1

DIOPT Version :9

Sequence 1:NP_647811.2 Gene:Ythdc1 / 38420 FlyBaseID:FBgn0027616 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_587783.2 Gene:mmi1 / 2539540 PomBaseID:SPCC736.12c Length:488 Species:Schizosaccharomyces pombe


Alignment Length:391 Identity:90/391 - (23%)
Similarity:151/391 - (38%) Gaps:75/391 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RSEASES----NGGDSSDSEPSISSVST-----------------ATSSLAG---SSKRKTKKPA 84
            ||...||    ..|...:|:|..||.||                 :.|.|.|   ..||:|..|.
pombe   116 RSLRRESMLYHTSGSYPESQPPYSSYSTDAPHYYHAGSESSAYYDSRSRLHGIQPPPKRRTLSPP 180

  Fly    85 KQSPQPAVETKSSKSSAKNKAKREPTPEELNGGKKKKRTDSGTKKTTSSEASDKVKSKSPDT--E 147
            .:.....|...||:...:...:|.|.       .......|......:..:|..|:| ||..  |
pombe   181 PRRLADPVVVGSSRYVEEEVYRRPPY-------TLASEVPSSASAYQAGYSSYPVRS-SPQLSHE 237

  Fly   148 D-RQPSAKKSRTKIP-SNANDSAGHKSDLSEAEDEKPSLPTLESDSESSDSDSGTQHKR------ 204
            | |...|....|:.| ..||..|.|...|  .|....|||       ||.:..|...::      
pombe   238 DTRHGIASSGSTRYPFVPANTRASHSPSL--LEPYAHSLP-------SSVAPVGAYPEKSSYLLS 293

  Fly   205 NGGNGGGNGRGKPSSKSSTPEKDSVGGGTHSHSQKGYDYMTKL--------NYLFRDTRFFLIKS 261
            |..|...:.:.||.:::|||...:....:...::|| :.::.:        |.:...:|:|::..
pombe   294 NSSNDSASRKEKPKARASTPPPLNFSRASEHRNEKG-ERISMINPRVVLDENGISHRSRYFIMLC 357

  Fly   262 NNSDNVQLSKNKSVWATLPQNDANLNQAFKEARNVLLIFSVNESGKFAGFARMAAP-SRRDIPQV 325
            :|...:..:|..|:||....:...::.|:|:| :|..||...::....|:|::.:. :..::|  
pombe   358 DNETAIAHAKKTSIWAVKKDSSKRISDAYKKA-SVYFIFVAQQTYNALGYAQVVSDLNSTELP-- 419

  Fly   326 AWVLPPSISPKALGGVIELDWICRKELSFNATL-HLHNTWNEGKPVKIGRDGQEIEPKIGGELCR 389
            .|      |..:..|.:.:.||....| |:|.: .:.:..:.|..   .|||.|:....|..||.
pombe   420 FW------SDSSHAGGVRIKWIKTCNL-FSAEISEIVSHMDHGSE---ARDGMEMMYDEGSRLCT 474

  Fly   390 L 390
            |
pombe   475 L 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ythdc1NP_647811.2 YTH 254..392 CDD:309322 33/139 (24%)
mmi1NP_587783.2 YTH 350..477 CDD:282058 33/139 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 44 1.000 Domainoid score I3593
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2345
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.