DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ythdc1 and Ythdf3

DIOPT Version :9

Sequence 1:NP_647811.2 Gene:Ythdc1 / 38420 FlyBaseID:FBgn0027616 Length:721 Species:Drosophila melanogaster
Sequence 2:XP_006535505.1 Gene:Ythdf3 / 229096 MGIID:1918850 Length:600 Species:Mus musculus


Alignment Length:397 Identity:87/397 - (21%)
Similarity:156/397 - (39%) Gaps:71/397 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 TRSEASESNGGDS--SDSEPSISSVSTATSSLAGSSKRKTKKPAKQSPQPAVETKSSKSSAKNKA 105
            |...|..|:|..|  :::.|.:||.:...:|.|..:    :||||  |||.::.|.:.....:..
Mouse   222 TVGTALSSSGMTSIATNNVPPVSSAAPKPTSWAAIA----RKPAK--PQPKLKPKGNVGIGGSAV 280

  Fly   106 KREPTPEELNGGKKKKRTDSGTKKTTSS---------------EASDKVKSKSPDTEDRQPSAKK 155
            ...|....:|.|...::........|..               :....|:|:.|..:.:.|..::
Mouse   281 PPPPIKHNMNIGTWDEKGSVVKAPPTQPVLPPQTIIQQPQPLIQPPPLVQSQLPQQQPQPPQPQQ 345

  Fly   156 SRTKIPSNANDSAGHKSDLSEAEDEKPSLPTLESDSESSDSDSGTQHKRNGGNGGGN-GRG---- 215
            .:...|         ::...:.:.::|.|    .:...:..:.||...:|.|.|..| |.|    
Mouse   346 QQGPQP---------QAQPHQVQSQQPQL----QNRWVAPRNRGTGFNQNNGTGSENFGLGVVPV 397

  Fly   216 --KPSSKSSTPEKDSVGGGTHSHSQKGYDYMTKLNYLFRDTRFFLIKSNNSDNVQLSKNKSVWAT 278
              .|||....|..:.: ...::::.|.:|:..|      :.|.|:|||.:.|::..|...|:|.:
Mouse   398 SASPSSVEVHPVLEKL-KAINNYNPKDFDWNLK------NGRVFIIKSYSEDDIHRSIKYSIWCS 455

  Fly   279 LPQNDANLNQAFKEARN---VLLIFSVNESGKFAGFARMAAPSRRDIPQVAWVLPPSISPKALGG 340
            ....:..|:.|::....   :.|:||||.||.|.|.|.|.:....:.....|      |.....|
Mouse   456 TEHGNKRLDAAYRSLNGKGPLYLLFSVNGSGHFCGVAEMKSVVDYNAYAGVW------SQDKWKG 514

  Fly   341 VIELDWICRKELSFNATLHLHNTWNEGKPVKIGRDGQEIEPKIGGELCRLFPEDEQIELTPILKK 405
            ..|:.||..|::..|...|:....|:.|||...||.||:            |.::..::..|:..
Mouse   515 KFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEV------------PLEKAKQVLKIIAT 567

  Fly   406 SKETARV 412
            .|.|..:
Mouse   568 FKHTTSI 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ythdc1NP_647811.2 YTH 254..392 CDD:309322 39/140 (28%)
Ythdf3XP_006535505.1 YTH 432..565 CDD:367840 40/150 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2345
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.