DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ythdc1 and ythdf3

DIOPT Version :9

Sequence 1:NP_647811.2 Gene:Ythdc1 / 38420 FlyBaseID:FBgn0027616 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_001120433.1 Gene:ythdf3 / 100145519 XenbaseID:XB-GENE-5752937 Length:572 Species:Xenopus tropicalis


Alignment Length:386 Identity:83/386 - (21%)
Similarity:146/386 - (37%) Gaps:60/386 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 TRSEASESNGGDS--SDSEPSISSVSTATSSLAGSSKRKTKKPAKQSPQPAVETKSSKSSAKNKA 105
            |...|..|.|..|  ::|.|.:||.:...:|.|..:    :||||  |||.::.|::.....:..
 Frog   205 TVGSALSSAGMTSIAANSVPPVSSSAPKPTSWAAIA----RKPAK--PQPKLKPKNNVGIGSSAV 263

  Fly   106 KREPTPEELNGGKKKKRTDSGTKKTTSSEASDKVKSKSPDTEDRQPSAKKSRTKIPSNANDSAGH 170
            ...|....:|.|   ...|.|....|....|  |....|..:..||..:    .:|...|     
 Frog   264 PPPPIKHNINIG---TWDDKGAIVKTPPIQS--VLPPQPVIQQPQPLTQ----PLPMVQN----- 314

  Fly   171 KSDLSEAEDEKPSLPTLESDSESSDSDSGTQHKRNGGNGGGNGRGKPSSKSSTPEKDSVGG---- 231
            :....:.:.:.|..|..:...:..:.....:::..|.|.......:..|....|...|..|    
 Frog   315 QLPQQQLQQQGPQQPPHQIQQQLQNRWVAPRNRGAGFNQNNVSGNENFSLGVVPVSSSPSGVEVH 379

  Fly   232 -------GTHSHSQKGYDYMTKLNYLFRDTRFFLIKSNNSDNVQLSKNKSVWATLPQNDANLNQA 289
                   ..::::.|.:|:..|      :.|.|:|||.:.|::..|...::|.:....:..|:.|
 Frog   380 PVLEKLKAINNYNPKDFDWSLK------NGRVFIIKSYSEDDIHRSIKYTIWCSTEHGNKRLDAA 438

  Fly   290 FKEARN---VLLIFSVNESGKFAGFARMAAPSRRDIPQVAWVLPPSISPKALGGVIELDWICRKE 351
            ::....   :.|:||||.||.|.|.|.|.:....:.....|      |.....|..::.|:..|:
 Frog   439 YRSLNGKGPLYLLFSVNGSGHFCGVAEMKSVVDYNAYAGVW------SQDKWKGKFDVKWVFVKD 497

  Fly   352 LSFNATLHLHNTWNEGKPVKIGRDGQEIEPKIGGELCRLFPEDEQIELTPILKKSKETARV 412
            :..|...|:....|:.|||...||.||:            |.::..::..|:...|.|..:
 Frog   498 VPNNQLRHIRLENNDNKPVTNSRDTQEV------------PLEKAKQVLKIIATFKHTTSI 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ythdc1NP_647811.2 YTH 254..392 CDD:309322 36/140 (26%)
ythdf3NP_001120433.1 YTH 404..537 CDD:367840 37/150 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2345
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.