DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and GPX8

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_564813.1 Gene:GPX8 / 842652 AraportID:AT1G63460 Length:167 Species:Arabidopsis thaliana


Alignment Length:164 Identity:77/164 - (46%)
Similarity:111/164 - (67%) Gaps:5/164 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 KNAASIYEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNF 141
            |...|:||.:::|..||:::|.:||.||:|:||:|||||:|.:||.:|.:|..:|.::||.||.|
plant     4 KEPESVYELSIEDAKGNNLALSQYKDKVLLIVNVASKCGMTNSNYTELNELYNRYKDKGLEILAF 68

  Fly   142 PCNQFGSQMPEADGEA--MVCHLRDSKADIGEVFAKVDVNGDNAAPLYKYLKAKQTGTLGSGIKW 204
            ||||||.:.|..:.:.  .||....|:..|   |.|::|||:||:||||:||..:.|..|..|:|
plant    69 PCNQFGDEEPGTNDQITDFVCTRFKSEFPI---FNKIEVNGENASPLYKFLKKGKWGIFGDDIQW 130

  Fly   205 NFTKFLVNKEGVPINRYAPTTDPMDIAKDIEKLL 238
            ||.||||:|.|..:.||.|||.|:.:..||:.||
plant   131 NFAKFLVDKNGQAVQRYYPTTSPLTLEHDIKNLL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 72/154 (47%)
GPX8NP_564813.1 Thioredoxin_like 1..167 CDD:412351 77/164 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 127 1.000 Domainoid score I1748
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 186 1.000 Inparanoid score I1405
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 1 1.000 - - FOG0000791
OrthoInspector 1 1.000 - - otm2424
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X276
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.