DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and GPX7

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_194915.2 Gene:GPX7 / 829316 AraportID:AT4G31870 Length:233 Species:Arabidopsis thaliana


Alignment Length:219 Identity:101/219 - (46%)
Similarity:131/219 - (59%) Gaps:9/219 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PGPVLELSRGQRQCLRLCTIMLPVSCAATPMNAISSAAQHSTAAAIDMSANGDYKNAA---SIYE 84
            |.|:.....|  ..||..|   ..|....|.|.:|..:.:|....:.......|..||   |:::
plant    19 PSPITSAFLG--PSLRFST---RTSKTRNPSNGVSVKSSNSHRFLVKSKNFSVYARAAAEKSVHD 78

  Fly    85 FTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPCNQFGSQ 149
            |||||..||||||:|:|||.:|:||:||:||||.:||.:|:.|.|||..:|..||.|||||||.|
plant    79 FTVKDIDGNDVSLDKFKGKPLLIVNVASRCGLTSSNYSELSQLYEKYKNQGFEILAFPCNQFGGQ 143

  Fly   150 MPEADGEAMVCHLRDSKADIGEVFAKVDVNGDNAAPLYKYLKAKQTGTLGSGIKWNFTKFLVNKE 214
            .|.::.|.........||:. .:|.||||||.:.||:||:||:...|.||..|||||.||||:|:
plant   144 EPGSNPEIKQFACTRFKAEF-PIFDKVDVNGPSTAPIYKFLKSNAGGFLGDIIKWNFEKFLVDKK 207

  Fly   215 GVPINRYAPTTDPMDIAKDIEKLL 238
            |..:.||.|||.|..|.|||:|||
plant   208 GKVVERYPPTTSPFQIEKDIQKLL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 82/152 (54%)
GPX7NP_194915.2 PLN02399 1..233 CDD:178021 101/219 (46%)
AhpC-TSA 78..213 CDD:278975 73/135 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 127 1.000 Domainoid score I1748
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 186 1.000 Inparanoid score I1405
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 1 1.000 - - FOG0000791
OrthoInspector 1 1.000 - - otm2424
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X276
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.