DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and GPX6

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_192897.2 Gene:GPX6 / 826765 AraportID:AT4G11600 Length:232 Species:Arabidopsis thaliana


Alignment Length:247 Identity:107/247 - (43%)
Similarity:141/247 - (57%) Gaps:40/247 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RQALRCYSMRRTPGPVLE-------------------LSRGQRQCLRLCTIMLPVSCAATPMNAI 56
            |.::|...:||| .|:|.                   |....|      .|.||:|.....:   
plant     3 RSSIRLLYIRRT-SPLLRSLSSSSSSSSSKRFDSAKPLFNSHR------IISLPISTTGAKL--- 57

  Fly    57 SSAAQHSTAAAIDMSANGDYKNAASIYEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNY 121
             |.::||.||:         ....|:|:|||||..||||.|..|||||:|:||:||:||||.:||
plant    58 -SRSEHSMAAS---------SEPKSLYDFTVKDAKGNDVDLSIYKGKVLLIVNVASQCGLTNSNY 112

  Fly   122 EKLTDLKEKYGERGLVILNFPCNQFGSQMPEADGEAMVCHLRDSKADIGEVFAKVDVNGDNAAPL 186
            .:|..|.|||...|..||.|||||||:|.|..:.|.:.......||:. .:|.|||||||.|||:
plant   113 TELAQLYEKYKGHGFEILAFPCNQFGNQEPGTNEEIVQFACTRFKAEY-PIFDKVDVNGDKAAPV 176

  Fly   187 YKYLKAKQTGTLGSGIKWNFTKFLVNKEGVPINRYAPTTDPMDIAKDIEKLL 238
            ||:||:.:.|..|.||||||.||||:|:|..::|:||||.|:.|.||::|||
plant   177 YKFLKSSKGGLFGDGIKWNFAKFLVDKDGNVVDRFAPTTSPLSIEKDVKKLL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 85/152 (56%)
GPX6NP_192897.2 Thioredoxin_like 66..229 CDD:294274 90/173 (52%)
AhpC-TSA 75..210 CDD:278975 75/135 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 127 1.000 Domainoid score I1748
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H133958
Inparanoid 1 1.050 186 1.000 Inparanoid score I1405
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 1 1.000 - - FOG0000791
OrthoInspector 1 1.000 - - otm2424
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X276
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.