DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and GPX5

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_191867.1 Gene:GPX5 / 825483 AraportID:AT3G63080 Length:173 Species:Arabidopsis thaliana


Alignment Length:158 Identity:90/158 - (56%)
Similarity:112/158 - (70%) Gaps:1/158 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 SIYEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPCNQ 145
            ||::|||||:.|.:|.|..|:|||:||||:|||||.|::||.:||:|..||.::|.|:|.|||||
plant    13 SIHQFTVKDSSGKEVDLSVYQGKVLLVVNVASKCGFTESNYTQLTELYRKYKDQGFVVLAFPCNQ 77

  Fly   146 FGSQMPEADGEAMVCHLRDSKADIGEVFAKVDVNGDNAAPLYKYLKAKQTGTLGSGIKWNFTKFL 210
            |.||.|....||........||:. .||.||.|||.||||:||:||:|:...|||.|||||||||
plant    78 FLSQEPGTSEEAHQFACTRFKAEY-PVFQKVRVNGQNAAPVYKFLKSKKPSFLGSRIKWNFTKFL 141

  Fly   211 VNKEGVPINRYAPTTDPMDIAKDIEKLL 238
            |.|:|..|:||..|..|:.|.|||||.|
plant   142 VGKDGQVIDRYGTTVSPLSIQKDIEKAL 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 85/152 (56%)
GPX5NP_191867.1 GSH_Peroxidase 14..165 CDD:238207 84/151 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 127 1.000 Domainoid score I1748
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 186 1.000 Inparanoid score I1405
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 1 1.000 - - FOG0000791
OrthoInspector 1 1.000 - - otm2424
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X276
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.730

Return to query results.
Submit another query.