DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and GPX3

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001189742.1 Gene:GPX3 / 818936 AraportID:AT2G43350 Length:206 Species:Arabidopsis thaliana


Alignment Length:164 Identity:85/164 - (51%)
Similarity:115/164 - (70%) Gaps:5/164 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 KNAASIYEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNF 141
            :::.|||..:|||..|.||||.|:.|||:|:||:|||||||..||:::..|..||..:|..||.|
plant    43 QSSTSIYNISVKDIEGKDVSLSKFTGKVLLIVNVASKCGLTHGNYKEMNILYAKYKTQGFEILAF 107

  Fly   142 PCNQFGSQMPEADGE--AMVCHLRDSKADIGEVFAKVDVNGDNAAPLYKYLKAKQTGTLGSGIKW 204
            ||||||||.|.::.|  ..||::  .||:. .:|.|::|||.|..|||.:||.::.|..|..|||
plant   108 PCNQFGSQEPGSNMEIKETVCNI--FKAEF-PIFDKIEVNGKNTCPLYNFLKEQKGGLFGDAIKW 169

  Fly   205 NFTKFLVNKEGVPINRYAPTTDPMDIAKDIEKLL 238
            ||.||||:::|..::||||||.|::|.|||.|||
plant   170 NFAKFLVDRQGNVVDRYAPTTSPLEIEKDIVKLL 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 80/154 (52%)
GPX3NP_001189742.1 Thioredoxin_like 42..206 CDD:412351 85/164 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 127 1.000 Domainoid score I1748
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 186 1.000 Inparanoid score I1405
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 1 1.000 - - FOG0000791
OrthoInspector 1 1.000 - - otm2424
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X276
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.730

Return to query results.
Submit another query.