DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and GPX1

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_180080.1 Gene:GPX1 / 817046 AraportID:AT2G25080 Length:236 Species:Arabidopsis thaliana


Alignment Length:158 Identity:83/158 - (52%)
Similarity:111/158 - (70%) Gaps:1/158 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 SIYEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPCNQ 145
            ::::|||||..|.||:|.|:||||:|:||:||:||||.:||.:|:.|.|||..:|..||.|||||
plant    78 TVHDFTVKDIDGKDVALNKFKGKVMLIVNVASRCGLTSSNYSELSHLYEKYKTQGFEILAFPCNQ 142

  Fly   146 FGSQMPEADGEAMVCHLRDSKADIGEVFAKVDVNGDNAAPLYKYLKAKQTGTLGSGIKWNFTKFL 210
            ||.|.|.::.|.........||:. .:|.||||||.:.||:|::||:...|.||..|||||.|||
plant   143 FGFQEPGSNSEIKQFACTRFKAEF-PIFDKVDVNGPSTAPIYEFLKSNAGGFLGGLIKWNFEKFL 206

  Fly   211 VNKEGVPINRYAPTTDPMDIAKDIEKLL 238
            ::|:|..:.||.|||.|..|.|||:|||
plant   207 IDKKGKVVERYPPTTSPFQIEKDIQKLL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 78/152 (51%)
GPX1NP_180080.1 PLN02399 1..236 CDD:178021 83/158 (53%)
AhpC-TSA 81..216 CDD:278975 70/135 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 127 1.000 Domainoid score I1748
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 186 1.000 Inparanoid score I1405
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 1 1.000 - - FOG0000791
OrthoInspector 1 1.000 - - otm2424
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X276
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.