DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and gpx3

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001131027.1 Gene:gpx3 / 798788 ZFINID:ZDB-GENE-070222-3 Length:222 Species:Danio rerio


Alignment Length:203 Identity:66/203 - (32%)
Similarity:96/203 - (47%) Gaps:31/203 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 AAQHSTAAAIDM----SANGDYKNAASIYEFTVKDTHGND-VSLEKYKGKVVLVVNIASKCGLTK 118
            |..|..||..:.    ||.||     |.:.:..|..:|.. :....|.||.|||||:|:..||| 
Zfish    16 ALMHKIAALSNTQACNSAAGD-----SFHNYGAKTINGTQFIPFSHYAGKHVLVVNVATYUGLT- 74

  Fly   119 NNYEKLTDLKEKYGERGLVILNFPCNQFGSQMPEADGEAM--VCHLRDSKADIG--EVFAKVDVN 179
            ..|.:|..|.|:....|..||.|||:|||.|.|..:.|.:  :.::|.....:.  ::|.|.|||
Zfish    75 FQYVELNALHEELRHLGFTILGFPCDQFGKQEPGENNEILSALKYVRPGNGFVPNFQLFEKGDVN 139

  Fly   180 GDNAAPLYKYLK------AKQTGTLG----------SGIKWNFTKFLVNKEGVPINRYAPTTDPM 228
            ||....|:.:||      .:..|...          :.|||||.|||::.:|.|:.|:.|..:..
Zfish   140 GDGEQALFTFLKNACPPVGESFGATSNRLFWEPLKVNDIKWNFEKFLLDPDGRPVMRWFPRVNVS 204

  Fly   229 DIAKDIEK 236
            ::..||.|
Zfish   205 EVRADILK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 55/173 (32%)
gpx3NP_001131027.1 GSH_Peroxidase 37..210 CDD:238207 55/173 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.