DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and gpx9

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001341101.1 Gene:gpx9 / 794084 ZFINID:ZDB-GENE-130603-13 Length:140 Species:Danio rerio


Alignment Length:131 Identity:42/131 - (32%)
Similarity:66/131 - (50%) Gaps:19/131 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 LKEKYGERGLVILNFPCNQFGSQMPEADGEAM--VCHLRDSKADIGE--VFAKVDVNGDNAAPLY 187
            |.:.||.:...:|.|||||||.|.||.:.|.:  :.|:|.....:.:  :|::::|||.:..|||
Zfish     4 LMDMYGGQRFTVLGFPCNQFGLQSPEENHETLNVLQHVRPGSGFLPKFPIFSRIEVNGSDEDPLY 68

  Fly   188 KYLKAK------QTGTL---------GSGIKWNFTKFLVNKEGVPINRYAPTTDPMDIAKDIEKL 237
            .|||..      ..|.:         .:.::|||.|||:..:|.|..||.......|:.:|:..|
Zfish    69 AYLKESLPFVNPVIGDIRKLYWSPIKANDVRWNFEKFLITADGRPYKRYDRNCPFEDVERDVSAL 133

  Fly   238 L 238
            |
Zfish   134 L 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 39/125 (31%)
gpx9NP_001341101.1 Thioredoxin_like <1..130 CDD:320948 39/125 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48732
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.