DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and Gpx6

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:XP_011242657.1 Gene:Gpx6 / 75512 MGIID:1922762 Length:258 Species:Mus musculus


Alignment Length:178 Identity:61/178 - (34%)
Similarity:92/178 - (51%) Gaps:21/178 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 SIYEFTVKDTHGND-VSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPCN 144
            ::||:......|.: |:.::|.||.:|.||:||.||||. .|.:|..|:|:.....:.:|.||||
Mouse    64 TVYEYGANTIDGGEFVNFQQYAGKHILFVNVASFCGLTA-TYPELNTLQEELKPFNVTVLGFPCN 127

  Fly   145 QFGSQMPEADGEAM--VCHLRDSKADIG--EVFAKVDVNGDNAAPLYKYLKAKQTGT---LGS-- 200
            |||.|.|..:.|.:  :.::|.....:.  ::|.|.||||||...::.:||.....|   .||  
Mouse   128 QFGKQEPGKNSEILLGLKYVRPGGGYVPNFQLFEKGDVNGDNEQKVFSFLKNSCPPTSELFGSPE 192

  Fly   201 ----------GIKWNFTKFLVNKEGVPINRYAPTTDPMDIAKDIEKLL 238
                      .|:|||.||||..:|||:.|:...|....:..||.:.|
Mouse   193 HLFWDPMKVHDIRWNFEKFLVGPDGVPVMRWFHHTPVRIVQSDIMEYL 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 58/172 (34%)
Gpx6XP_011242657.1 GSH_Peroxidase 64..223 CDD:238207 56/159 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.