DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and Gpx8

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_081403.1 Gene:Gpx8 / 69590 MGIID:1916840 Length:209 Species:Mus musculus


Alignment Length:151 Identity:55/151 - (36%)
Similarity:84/151 - (55%) Gaps:10/151 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 SIYEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPCNQ 145
            |.|.|.|||..|..|||||:|||..||||:||.|..|..:|:.|.:|.:::|.....:|.|||||
Mouse    46 SFYSFEVKDAKGRTVSLEKFKGKASLVVNVASDCRFTDKSYQTLRELHKEFGPYHFNVLAFPCNQ 110

  Fly   146 FGSQMPEADGEAMVCHLRDSKADIGEVFAKVDVNGDNAAPLYKYL--KAKQTGTLGSGIKWNFTK 208
            ||...|::..| :....|.:......:|.|:.:.|..|.|.::::  .:|:..      :|||.|
Mouse   111 FGESEPKSSKE-VESFARQNYGVTFPIFHKIKILGPEAEPAFRFIVDSSKKEP------RWNFWK 168

  Fly   209 FLVNKEGVPINRYAPTTDPMD 229
            :|||.||..:..:.| .:|::
Mouse   169 YLVNPEGQVVKFWRP-EEPLE 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 55/151 (36%)
Gpx8NP_081403.1 gpx7 46..198 CDD:131592 55/151 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16331
SonicParanoid 1 1.000 - - X276
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.710

Return to query results.
Submit another query.