DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and Gpx7

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_077160.1 Gene:Gpx7 / 67305 MGIID:1914555 Length:186 Species:Mus musculus


Alignment Length:160 Identity:61/160 - (38%)
Similarity:83/160 - (51%) Gaps:9/160 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 YEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPCNQFG 147
            |:|...:..|..||||||:|.|.||||:||:||.|..||..|..|:...|.....:|.|||||||
Mouse    25 YDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQNYRALQQLQRDLGPHHFNVLAFPCNQFG 89

  Fly   148 SQMPEADGEAMVCHLRDSKADIGEVFAKVDVNGDNAAPLYKYLKAKQTGTLGSGIKWNFTKFLVN 212
            .|.|:.:.|......|...... .:|:|:.|.|..|.|.:|||    |.|.|....|||.|:||:
Mouse    90 QQEPDTNREIENFARRTYSVSF-PMFSKIAVTGTGAHPAFKYL----TQTSGKEPTWNFWKYLVD 149

  Fly   213 KEGVPINRYAPTTDPMD----IAKDIEKLL 238
            .:|..:..:.||....:    |.:.:.||:
Mouse   150 PDGKVVGAWDPTVPVAEIKPRITEQVMKLI 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 59/154 (38%)
Gpx7NP_077160.1 gpx7 23..175 CDD:131592 59/154 (38%)
AhpC-TSA 26..155 CDD:278975 55/133 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 93 1.000 Domainoid score I7531
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16331
SonicParanoid 1 1.000 - - X276
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.700

Return to query results.
Submit another query.