DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and Gpx4

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001032830.2 Gene:Gpx4 / 625249 MGIID:104767 Length:253 Species:Mus musculus


Alignment Length:224 Identity:86/224 - (38%)
Similarity:132/224 - (58%) Gaps:12/224 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SMRRTPGPVLELSRGQRQCLRLCTIMLPVSCAATPMNAISSAAQH-STAAAIDMSAN-GDYKNAA 80
            |.|:.|||....:|.:|:.......|.|:.....|...:....|: :::..:.:.|: .|::.|.
Mouse    31 SPRKRPGPRRRKARARRRRRARPRRMEPIPEPFNPGPLLQEPPQYCNSSEFLGLCASRDDWRCAR 95

  Fly    81 SIYEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPCNQ 145
            |::||:.||..|:.|.|:||:|.|.:|.|:||:.|.|..||.:|.||..:|.|.||.||.|||||
Mouse    96 SMHEFSAKDIDGHMVCLDKYRGFVCIVTNVASQUGKTDVNYTQLVDLHARYAECGLRILAFPCNQ 160

  Fly   146 FGSQMPEADGEAMVCHLRDSKADIG---EVFAKVDVNGDNAAPLYKYLKA--KQTGTLGSGIKWN 205
            ||.|.|.::.|     :::..|...   ::::|:.||||:|.||:|::|.  |..|.||:.||||
Mouse   161 FGRQEPGSNQE-----IKEFAAGYNVKFDMYSKICVNGDDAHPLWKWMKVQPKGRGMLGNAIKWN 220

  Fly   206 FTKFLVNKEGVPINRYAPTTDPMDIAKDI 234
            |||||::|.|..:.||.|..:|..|.||:
Mouse   221 FTKFLIDKNGCVVKRYGPMEEPQVIEKDL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 71/157 (45%)
Gpx4NP_001032830.2 GSH_Peroxidase 96..249 CDD:238207 71/157 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 93 1.000 Domainoid score I7531
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4454
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48732
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 1 1.000 - - FOG0000791
OrthoInspector 1 1.000 - - otm43280
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16331
SonicParanoid 1 1.000 - - X276
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.810

Return to query results.
Submit another query.