DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gtpx and Gpx4

DIOPT Version :10

Sequence 1:NP_728869.1 Gene:Gtpx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001032830.2 Gene:Gpx4 / 625249 MGIID:104767 Length:253 Species:Mus musculus


Alignment Length:121 Identity:27/121 - (22%)
Similarity:42/121 - (34%) Gaps:48/121 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 CNKTSKIKIWLTKNSINNREIGLVEDVVWIKLMTVLIPDF---------PKL------PFRWYNR 299
            |..:|..::.||:...|    ||..|:. .:..|.|:..|         |||      |.|..  
Mouse   870 CETSSGDELLLTEMMFN----GLFNDLT-AEQATALLSCFVFQENANEMPKLTEQLGGPLRQM-- 927

  Fly   300 PDLTYFLDNDDAKRLVICCYDETQQVYIYIVRRNIVKKIKIDLFED-LLDQSSPHL 354
                    .:.|||:.                 .:..:.|:::.|| .|:|..|||
Mouse   928 --------QECAKRIA-----------------KVSAEAKLEVDEDSYLNQFRPHL 958

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GtpxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207
Gpx4NP_001032830.2 GSH_Peroxidase 96..249 CDD:238207
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.