DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and gpx7

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001018337.1 Gene:gpx7 / 552981 ZFINID:ZDB-GENE-050522-419 Length:186 Species:Danio rerio


Alignment Length:158 Identity:56/158 - (35%)
Similarity:87/158 - (55%) Gaps:9/158 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 YEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPCNQFG 147
            |.|.|.::.|..||||||:|.|.|.||:||:||.|..:|:.|..|::.:|.....:|.|||||||
Zfish    25 YTFKVVNSRGRLVSLEKYRGSVSLAVNVASECGYTDEHYKDLQQLQKDFGPFHFNVLAFPCNQFG 89

  Fly   148 SQMPEADGEAMVCHLRDSKADIGEVFAKVDVNGDNAAPLYKYL--KAKQTGTLGSGIKWNFTKFL 210
            .|.|.:|.| :...:|........:|:|:.|.|..|...||||  .:::..|      |||.|:|
Zfish    90 QQEPGSDKE-IDSFVRRVYGVSFPIFSKIAVVGIGANNAYKYLVEASRKEPT------WNFWKYL 147

  Fly   211 VNKEGVPINRYAPTTDPMDIAKDIEKLL 238
            ::.:|..::.:.|.....:|...|.:::
Zfish   148 IDTDGKVVDAWGPEVSVKEIRPRITEMV 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 55/152 (36%)
gpx7NP_001018337.1 Thioredoxin_like 23..175 CDD:294274 56/156 (36%)
AhpC-TSA 27..157 CDD:278975 52/136 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16331
SonicParanoid 1 1.000 - - X276
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.710

Return to query results.
Submit another query.