DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and gpx1

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001015740.2 Gene:gpx1 / 548457 XenbaseID:XB-GENE-922630 Length:195 Species:Xenopus tropicalis


Alignment Length:186 Identity:65/186 - (34%)
Similarity:99/186 - (53%) Gaps:32/186 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 SIYEFTVK-DTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPCN 144
            ::|||:.: .:.|.:.:|.:|||:|:|:.|:||..|.|..:|.:::.|:..||.|||.:|.||||
 Frog     9 TVYEFSARLLSAGENTALSQYKGRVLLIENVASLUGTTIRDYTQMSRLQSMYGPRGLQVLAFPCN 73

  Fly   145 QFGSQMPEADGEAM--VCHLRDSKADIG------EVFAKVDVNGDNAAPLYKYLKAK-------- 193
            |||.|....:.|.:  :.|:|..    |      .:|.||||||:...||:.:||.:        
 Frog    74 QFGHQENSGNQEILNILKHVRPG----GGFEPNFPLFEKVDVNGEKEHPLFTFLKGQLPYPSDDS 134

  Fly   194 -----------QTGTLGSGIKWNFTKFLVNKEGVPINRYAPTTDPMDIAKDIEKLL 238
                       .:....:.|.|||.|||:.:.|||..||....:..:|.:||||||
 Frog   135 ISLMQDPKSIIWSPVRRNDIAWNFEKFLIARNGVPYKRYGRRFETFNIQQDIEKLL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 59/180 (33%)
gpx1NP_001015740.2 GSH_Peroxidase 9..186 CDD:238207 59/180 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I12207
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48732
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.