DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and gpx8

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_956516.1 Gene:gpx8 / 393191 ZFINID:ZDB-GENE-040426-965 Length:210 Species:Danio rerio


Alignment Length:165 Identity:56/165 - (33%)
Similarity:84/165 - (50%) Gaps:11/165 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 KNAASIYEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNF 141
            :.....|.:.|||..|..||||||:|||.||||:||...||:.:|..|.:|..:.|.....:|.|
Zfish    43 RKTKDFYSYEVKDARGRTVSLEKYRGKVSLVVNVASGSELTEQSYRALQELHRELGTSHFNVLAF 107

  Fly   142 PCNQFGSQMPEADGEAMVCHLRDSKADIG---EVFAKVDVNGDNAAPLYKYLKAKQTGTLGSGIK 203
            ||:|:|........|....    :|::.|   .:|.|:.:.|..|.|.:::|    |.::....:
Zfish   108 PCSQYGDTESGTSREIEAF----AKSNYGVTFPIFNKIKIMGSEAEPAFRFL----TDSVQKIPR 164

  Fly   204 WNFTKFLVNKEGVPINRYAPTTDPMDIAKDIEKLL 238
            |||.||||:.||..:..:.|.....||.|:...|:
Zfish   165 WNFWKFLVSPEGQVVRFWKPEEPVSDIRKEATTLV 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 55/155 (35%)
gpx8NP_956516.1 Thioredoxin_like 47..199 CDD:294274 55/159 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16331
SonicParanoid 1 1.000 - - X276
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.710

Return to query results.
Submit another query.