DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and gpx4b

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001025241.2 Gene:gpx4b / 352929 ZFINID:ZDB-GENE-030410-3 Length:191 Species:Danio rerio


Alignment Length:185 Identity:87/185 - (47%)
Similarity:119/185 - (64%) Gaps:5/185 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 ISSAAQHSTAAAIDMSANGDYKNAASIYEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNN 120
            :.:....|.|.|:...|| |:::|.|||||:..|..|||||||||:|.|.::.|:||| |.|..|
Zfish    10 VGAVGSKSFARAMCAQAN-DWQSAKSIYEFSAIDIDGNDVSLEKYRGYVCIITNVASKUGKTPVN 73

  Fly   121 YEKLTDLKEKYGERGLVILNFPCNQFGSQMPEADGEAMVCHLRDSKADIGEVFAKVDVNGDNAAP 185
            |.:|..:...|.|:||.||.|||||||.|.|.::.|... ..:...|:. ::|:|:|||||.|.|
Zfish    74 YTQLAAMHVTYAEKGLRILGFPCNQFGKQEPGSEAEIKE-FAKGYNAEF-DLFSKIDVNGDAAHP 136

  Fly   186 LYKYLK--AKQTGTLGSGIKWNFTKFLVNKEGVPINRYAPTTDPMDIAKDIEKLL 238
            |:|::|  .|..||||:.|||||||||:::||..:.||.|..||..:.||:.|.|
Zfish   137 LWKWMKEQPKGRGTLGNNIKWNFTKFLIDREGQVVKRYGPMDDPSVVEKDLPKYL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 77/154 (50%)
gpx4bNP_001025241.2 GSH_Peroxidase 34..187 CDD:238207 77/154 (50%)
AhpC-TSA 37..173 CDD:278975 68/137 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I6025
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I4090
OMA 1 1.010 - - QHG48732
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 1 1.000 - - FOG0000791
OrthoInspector 1 1.000 - - otm25908
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16331
SonicParanoid 1 1.000 - - X276
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.