DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and gpx4a

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001333466.1 Gene:gpx4a / 352928 ZFINID:ZDB-GENE-030410-2 Length:194 Species:Danio rerio


Alignment Length:184 Identity:88/184 - (47%)
Similarity:120/184 - (65%) Gaps:9/184 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SSAAQHSTAAAIDMSANGDYKNAASIYEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNY 121
            ||....:|:|.::     |::.|.||||||..|..||:||||||:||||::.|:||| |.|..||
Zfish    18 SSGIIGATSAQLE-----DWQTAKSIYEFTATDIDGNEVSLEKYRGKVVIITNVASKUGKTPVNY 77

  Fly   122 EKLTDLKEKYGERGLVILNFPCNQFGSQMPEADGEAMVCHLRDSKADIGEVFAKVDVNGDNAAPL 186
            .:..::..||.||||.||.||.||||.|.|..:.:... ..:...|:. ::|:|:|||||.|.||
Zfish    78 SQFAEMHAKYSERGLRILAFPSNQFGRQEPGTNSQIKE-FAKSYNAEF-DMFSKIDVNGDGAHPL 140

  Fly   187 YKYLKAKQTGT--LGSGIKWNFTKFLVNKEGVPINRYAPTTDPMDIAKDIEKLL 238
            :|:||.:..|.  ||:||||||||||:|:||..:.||:|..||..:.||:.|.|
Zfish   141 WKWLKDQPNGKGFLGNGIKWNFTKFLINREGQVVKRYSPLQDPSVVEKDLSKYL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 79/154 (51%)
gpx4aNP_001333466.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I6025
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H133958
Inparanoid 1 1.050 171 1.000 Inparanoid score I4090
OMA 1 1.010 - - QHG48732
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 1 1.000 - - FOG0000791
OrthoInspector 1 1.000 - - otm25908
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X276
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.